| Clone Name | baet71e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TOC34_ARATH (Q38906) Translocase of chloroplast 34 (EC 3.6.5.-) ... | 31 | 0.73 | 2 | CAD22_MOUSE (Q9WTP5) Cadherin-22 precursor (Pituitary and brain ... | 30 | 1.6 |
|---|
>TOC34_ARATH (Q38906) Translocase of chloroplast 34 (EC 3.6.5.-) (34 kDa| chloroplast outer envelope protein) (GTP-binding protein OEP34) (AtToc34) Length = 313 Score = 31.2 bits (69), Expect = 0.73 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 169 REWVGLQQFPAATQT 213 REW+G+QQFP ATQ+ Sbjct: 8 REWIGIQQFPPATQS 22
>CAD22_MOUSE (Q9WTP5) Cadherin-22 precursor (Pituitary and brain cadherin)| (PB-cadherin) Length = 813 Score = 30.0 bits (66), Expect = 1.6 Identities = 21/49 (42%), Positives = 27/49 (55%) Frame = +1 Query: 49 VLFPVSEHLPAESRV*PPAESASLSPGGKEERAVMAAPIPREWVGLQQF 195 +L P+ HL A S PA S SLSPG +E+ + A + R WV Q F Sbjct: 23 LLLPLLGHLWAAST---PAPS-SLSPGAQEDNQLGAGRVKRGWVWNQFF 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,435,698 Number of Sequences: 219361 Number of extensions: 361122 Number of successful extensions: 928 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)