| Clone Name | baet71d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein | 58 | 6e-09 | 2 | 14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor | 42 | 3e-04 | 3 | CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor ... | 39 | 0.004 | 4 | Y297_ANASP (Q8Z006) UPF0284 protein Alr0297 | 28 | 4.0 |
|---|
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 57.8 bits (138), Expect = 6e-09 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 302 CPVDVLKLVACVDALNGVVHAXVGANASETCCPLLSG 412 CP+D LKL ACVD L G++H +G +A +TCCPLL G Sbjct: 261 CPIDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLGG 297
>14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor| Length = 137 Score = 42.0 bits (97), Expect = 3e-04 Identities = 19/39 (48%), Positives = 23/39 (58%) Frame = +2 Query: 296 GKCPVDVLKLVACVDALNGVVHAXVGANASETCCPLLSG 412 GKCP D LKL C D LN V + +G+ + CC LL G Sbjct: 52 GKCPRDALKLGVCADVLNLVHNVVIGSPPTLPCCSLLEG 90
>CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor (Root-specific| protein ZRP3) Length = 129 Score = 38.5 bits (88), Expect = 0.004 Identities = 19/39 (48%), Positives = 21/39 (53%) Frame = +2 Query: 296 GKCPVDVLKLVACVDALNGVVHAXVGANASETCCPLLSG 412 G+CP+D LKL C L V VG E CCPLL G Sbjct: 46 GRCPIDALKLKVCAKVLGLV---KVGLPQYEQCCPLLEG 81
>Y297_ANASP (Q8Z006) UPF0284 protein Alr0297| Length = 384 Score = 28.5 bits (62), Expect = 4.0 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = +2 Query: 299 KCPVDVLKLVACVDALNGVVHAXVGANASETCCPLLSG 412 K P+D LKLVA V VV A + AS C +L+G Sbjct: 222 KSPIDPLKLVAAVGDPMQVVVAGMAIAASRGCGVMLAG 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,025,716 Number of Sequences: 219361 Number of extensions: 170643 Number of successful extensions: 374 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)