| Clone Name | baet71c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PYGO1_MOUSE (Q9D0P5) Pygopus homolog 1 | 30 | 2.4 |
|---|
>PYGO1_MOUSE (Q9D0P5) Pygopus homolog 1| Length = 417 Score = 30.4 bits (67), Expect = 2.4 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +2 Query: 59 TSKFSSGWGIDRIMAPAPVEFVGAREAGG---VGGDA 160 T++ S+ WG D MA V+ + REA G VGGDA Sbjct: 381 TAEASAVWGCDTCMADKDVQLMRTREAFGPPAVGGDA 417 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,273,940 Number of Sequences: 219361 Number of extensions: 535546 Number of successful extensions: 1546 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1545 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)