| Clone Name | baet70e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_HRV1A (P23008) Genome polyprotein [Contains: Coat protein V... | 28 | 8.8 |
|---|
>POLG_HRV1A (P23008) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D)] (Fragments) Length = 832 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -1 Query: 387 ISWIACCSWRWQEDVRYWSWNYRGCWHQT---CPPMDPR 280 + W++ +R D +Y Y CW+QT PP P+ Sbjct: 474 VPWVSASHFRLTADNKYSMAGYITCWYQTNLVVPPSTPQ 512 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,094,581 Number of Sequences: 219361 Number of extensions: 1153513 Number of successful extensions: 2271 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2271 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)