ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet70d08 |
|---|---|
| Clone Library Name | barley_pub |
>CYSP_SCHMA (P25792) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sm31) Length = 340 Score = 76.3 bits (186), Expect = 4e-14 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 6/100 (6%) Frame = +3 Query: 198 IIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSE----- 362 II +N HPNAGW A + ++++ + +G + P L R K P + Sbjct: 33 IISYINEHPNAGWRAEKSNRF--HSLDDARIQMGARREEPDL----RRKRRPTVDHNDWN 86 Query: 363 -QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECL 479 ++P FD+R KW GC +I I DQ CGSCW+FGAVE + Sbjct: 87 VEIPSNFDSRKKWPGCKSIATIRDQSRCGSCWSFGAVEAM 126
>CATB_MOUSE (P10605) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 74.7 bits (182), Expect = 1e-13 Identities = 42/91 (46%), Positives = 48/91 (52%), Gaps = 3/91 (3%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGVK---PTPPGLLAGVRTKTHPRSEQLPKEFDA 386 N N W AG N Y N I K + G P PG +A LP+ FDA Sbjct: 35 NKQNTTWQAGRNFY--NVDISYLKKLCGTVLGGPKLPGRVA------FGEDIDLPETFDA 86 Query: 387 RSKWSGCSTIGKILDQGHCGSCWAFGAVECL 479 R +WS C TIG+I DQG CGSCWAFGAVE + Sbjct: 87 REQWSNCPTIGQIRDQGSCGSCWAFGAVEAI 117
>CYSP_SCHJA (P43157) Cathepsin B-like cysteine proteinase precursor (EC| 3.4.22.-) (Antigen Sj31) Length = 342 Score = 72.8 bits (177), Expect = 5e-13 Identities = 33/96 (34%), Positives = 54/96 (56%), Gaps = 2/96 (2%) Frame = +3 Query: 198 IIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKT--HPRSEQLP 371 +I +N HP+AGW A + ++++ + ++G + + R H + ++P Sbjct: 34 MISFINEHPDAGWKADKSDRF--HSLDDARILMGARKEDAEMKRNRRPTVDHHDLNVEIP 91 Query: 372 KEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECL 479 +FD+R KW C +I +I DQ CGSCWAFGAVE + Sbjct: 92 SQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAM 127
>CATB_RAT (P00787) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (RSG-2)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 72.8 bits (177), Expect = 5e-13 Identities = 42/95 (44%), Positives = 49/95 (51%), Gaps = 2/95 (2%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSK 395 N N W AG N Y N I K + G P L V LP+ FDAR + Sbjct: 35 NKQNTTWQAGRNFY--NVDISYLKKLCGTVLGGPNLPERVGFS---EDINLPESFDAREQ 89 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECL--QIVLH 494 WS C TI +I DQG CGSCWAFGAVE + +I +H Sbjct: 90 WSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIH 124
>CATB_HUMAN (P07858) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1) (APP| secretase) (APPS) [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 70.9 bits (172), Expect = 2e-12 Identities = 41/98 (41%), Positives = 50/98 (51%), Gaps = 5/98 (5%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGV---KPTPPGLLAGVRTKTHPRSEQLPKEFDA 386 N N W AGHN Y N + K + G P PP + +LP FDA Sbjct: 35 NKRNTTWQAGHNFY--NVDMSYLKRLCGTFLGGPKPP------QRVMFTEDLKLPASFDA 86 Query: 387 RSKWSGCSTIGKILDQGHCGSCWAFGAVECL--QIVLH 494 R +W C TI +I DQG CGSCWAFGAVE + +I +H Sbjct: 87 REQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIH 124
>CATB_BOVIN (P07688) Cathepsin B precursor (EC 3.4.22.1) [Contains: Cathepsin B| light chain; Cathepsin B heavy chain] Length = 335 Score = 70.5 bits (171), Expect = 2e-12 Identities = 40/95 (42%), Positives = 49/95 (51%), Gaps = 2/95 (2%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSK 395 N N W AGHN Y N + K + G P L + LP+ FDAR + Sbjct: 35 NKQNTTWKAGHNFY--NVDLSYVKKLCGAILGGPKL---PQRDAFAADVVLPESFDAREQ 89 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECL--QIVLH 494 W C TI +I DQG CGSCWAFGAVE + +I +H Sbjct: 90 WPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIH 124
>CATB_CHICK (P43233) Cathepsin B precursor (EC 3.4.22.1) (Cathepsin B1)| [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 340 Score = 59.7 bits (143), Expect = 4e-09 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECL 479 LP FD R +W C TI +I DQG CGSCWAFGAVE + Sbjct: 80 LPDTFDTRKQWPNCPTISEIRDQGSCGSCWAFGAVEAI 117
>CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precursor (EC| 3.4.22.-) (Cysteine protease-related 3) Length = 370 Score = 56.6 bits (135), Expect = 4e-08 Identities = 38/101 (37%), Positives = 51/101 (50%), Gaps = 4/101 (3%) Frame = +3 Query: 189 QKGIIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSE-- 362 QK ++ VN W A HN ++ + ++ FK M P + V ++ R E Sbjct: 32 QKVLVDHVNT-VQTSWVAEHNE-ISEFEMK-FKVMDVKFAEPLEKDSDVASELFVRGEIV 88 Query: 363 --QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECL 479 LP FDAR KW C+TI I +Q CGSCWAFGA E + Sbjct: 89 PEPLPDTFDAREKWPDCNTIKLIRNQATCGSCWAFGAAEVI 129
>CPR6_CAEEL (P43510) Cathepsin B-like cysteine proteinase 6 precursor (EC| 3.4.22.-) (Cysteine protease-related 6) Length = 379 Score = 55.5 bits (132), Expect = 8e-08 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = +3 Query: 339 TKTHPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECL 479 +KT +P+ FD+R W C +I I DQ CGSCWAFGAVE + Sbjct: 96 SKTKDLDLDIPESFDSRDNWPKCDSIKVIRDQSSCGSCWAFGAVEAM 142
>CPR5_CAEEL (P43509) Cathepsin B-like cysteine proteinase 5 precursor (EC| 3.4.22.-) (Cysteine protease-related 5) Length = 344 Score = 55.1 bits (131), Expect = 1e-07 Identities = 27/82 (32%), Positives = 37/82 (45%) Frame = +3 Query: 234 WTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCST 413 WTAGH ++ + + P + S+ +P FDAR +W C + Sbjct: 43 WTAGHQVIPKEKITKKLMDVKYLVPHKDEDIVATEV-----SDAIPDHFDARDQWPNCMS 97 Query: 414 IGKILDQGHCGSCWAFGAVECL 479 I I DQ CGSCWAF A E + Sbjct: 98 INNIRDQSDCGSCWAFAAAEAI 119
>CPR4_CAEEL (P43508) Cathepsin B-like cysteine proteinase 4 precursor (EC| 3.4.22.-) (Cysteine protease-related 4) Length = 335 Score = 53.5 bits (127), Expect = 3e-07 Identities = 30/72 (41%), Positives = 36/72 (50%), Gaps = 4/72 (5%) Frame = +3 Query: 270 TIEQFKHMLG----VKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQG 437 TIEQ K L V P P + K + +P FDAR++W C +I I DQ Sbjct: 48 TIEQVKKRLMRTEFVAPHTPDVEV---VKHDINEDTIPATFDARTQWPNCMSINNIRDQS 104 Query: 438 HCGSCWAFGAVE 473 CGSCWAF A E Sbjct: 105 DCGSCWAFAAAE 116
>CPR1_CAEEL (P25807) Gut-specific cysteine proteinase precursor (EC 3.4.22.-)| Length = 329 Score = 52.8 bits (125), Expect = 5e-07 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECL 479 +P FD+R++WS C +I I DQ CGSCWAFGA E + Sbjct: 85 VPATFDSRTQWSECKSIKLIRDQATCGSCWAFGAAEMI 122
>CATB1_GIALA (P92131) Cathepsin B-like CP1 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B1) Length = 303 Score = 50.1 bits (118), Expect = 3e-06 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 9/91 (9%) Frame = +3 Query: 225 NAGWTAGHNPYLANYTIEQFKHMLGVKPT---------PPGLLAGVRTKTHPRSEQLPKE 377 N W AG N T ++F+ ML ++P PP + V+ P +P + Sbjct: 28 NPPWKAGMPKRFENVTEDEFRSML-IRPDRLRARSGSLPPISITEVQELVDP----IPPQ 82 Query: 378 FDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 FD R ++ C + LDQG CGSCWAF A+ Sbjct: 83 FDFRDEYPQC--VKPALDQGSCGSCWAFSAI 111
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 48.1 bits (113), Expect = 1e-05 Identities = 31/87 (35%), Positives = 45/87 (51%), Gaps = 1/87 (1%) Frame = +3 Query: 231 GWTAGHNPYLANYTIEQFKH-MLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGC 407 G+ G N + A+ T E+F+ LG K AG R + H E+LP+ D R K Sbjct: 96 GFRLGMNRF-ADLTNEEFRATFLGAKVAERSRAAGERYR-HDGVEELPESVDWREK---- 149 Query: 408 STIGKILDQGHCGSCWAFGAVECLQIV 488 + + +QG CGSCWAF AV ++ + Sbjct: 150 GAVAPVKNQGQCGSCWAFSAVSTVESI 176
>TINAG_HUMAN (Q9UJW2) Tubulointerstitial nephritis antigen (TIN-Ag)| Length = 476 Score = 46.6 bits (109), Expect = 4e-05 Identities = 35/95 (36%), Positives = 49/95 (51%), Gaps = 2/95 (2%) Frame = +3 Query: 183 IIQKGIIQTVNNHPNAGWTAGHNPYLANYTIEQ-FKHMLGVKPTPPGLLA-GVRTKTHPR 356 +++ +I+ VN + GWTA + T+E FK LG P P LL+ T + P Sbjct: 155 LVRPELIEQVNKG-DYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPMLLSMNEMTASLPA 213 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAF 461 + LP+ F A KW G T G LDQ +C + WAF Sbjct: 214 TTDLPEFFVASYKWPGW-THGP-LDQKNCAASWAF 246
>CYSP1_OSTOS (P25802) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 341 Score = 45.4 bits (106), Expect = 8e-05 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECL 479 ++ +P+ +D R +W+ CS++ I DQ +CGSCWA + + Sbjct: 88 NDDIPESYDPRIQWANCSSLFHIPDQANCGSCWAVSSAAAM 128
>CATB2_GIALA (P92132) Cathepsin B-like CP2 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B2) Length = 300 Score = 43.5 bits (101), Expect = 3e-04 Identities = 24/82 (29%), Positives = 36/82 (43%) Frame = +3 Query: 225 NAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSG 404 N W AG T ++ +L T + +P+ FD R ++ Sbjct: 28 NPRWKAGIPKRFEGLTKDEISSLLMPVSFLKNAKGAAPRGTFTDKDDVPESFDFREEYPH 87 Query: 405 CSTIGKILDQGHCGSCWAFGAV 470 C I +++DQG CGSCWAF +V Sbjct: 88 C--IPEVVDQGGCGSCWAFSSV 107
>TINAL_RAT (Q9EQT5) Tubulointerstitial nephritis antigen-like precursor| (Glucocorticoid-inducible protein 5) Length = 467 Score = 43.5 bits (101), Expect = 3e-04 Identities = 30/108 (27%), Positives = 54/108 (50%), Gaps = 4/108 (3%) Frame = +3 Query: 183 IIQKGIIQTVNNHPNAGWTAGHNPYLANYTIEQ-FKHMLG-VKPTPPGLLAGVRTKTHPR 356 ++ +I+ +N N GW AG++ T+++ ++ LG ++P+ + + Sbjct: 140 LVDPAMIKAINRG-NYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMNEIYTVLGQ 198 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAF--GAVECLQIVLH 494 E LP F+A KW + I + LDQG+C WAF AV ++ +H Sbjct: 199 GEVLPTAFEASEKWP--NLIHEPLDQGNCAGSWAFSTAAVASDRVSIH 244
>TINAL_HUMAN (Q9GZM7) Tubulointerstitial nephritis antigen-like precursor| (Tubulointerstitial nephritis antigen-related protein) (TIN Ag-related protein) (TIN-Ag-RP) (Glucocorticoid-inducible protein 5) (Oxidized LDL-responsive gene 2 protein) (OLRG-2) Length = 467 Score = 43.5 bits (101), Expect = 3e-04 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 5/98 (5%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQ-FKHMLG-VKPTPPGL-LAGVRTKTHPRSEQLPKEFDA 386 N N GW AG++ T+++ ++ LG ++P+ + + + T +P E LP F+A Sbjct: 151 NQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNP-GEVLPTAFEA 209 Query: 387 RSKWSGCSTIGKILDQGHCGSCWAF--GAVECLQIVLH 494 KW + I + LDQG+C WAF AV ++ +H Sbjct: 210 SEKWP--NLIHEPLDQGNCAGSWAFSTAAVASDRVSIH 245
>TINAL_MOUSE (Q99JR5) Tubulointerstitial nephritis antigen-like precursor| (Androgen-regulated gene 1 protein) (Adrenocortical zonation factor 1) (AZ-1) (Tubulointersititial nephritis antigen-related protein) (TARP) Length = 466 Score = 43.1 bits (100), Expect = 4e-04 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 4/97 (4%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQ-FKHMLG-VKPTPPGLLAGVRTKTHPRSEQLPKEFDAR 389 N N GW AG++ T+++ ++ LG ++P+ + + E LP F+A Sbjct: 150 NRGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSTVMNMNEIYTVLGQGEVLPTAFEAS 209 Query: 390 SKWSGCSTIGKILDQGHCGSCWAF--GAVECLQIVLH 494 KW + I + LDQG+C WAF AV ++ +H Sbjct: 210 EKWP--NLIHEPLDQGNCAGSWAFSTAAVASDRVSIH 244
>CATL_RAT (P07154) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (Cyclic protein 2) (CP-2) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 42.7 bits (99), Expect = 5e-04 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P Q+PK D R K GC T + +QG CGSCWAF A CL+ Sbjct: 109 PLMLQIPKTVDWREK--GCVT--PVKNQGQCGSCWAFSASGCLE 148
>CPR3_ARATH (Q9SUT0) Probable cysteine proteinase At4g11310 precursor (EC| 3.4.22.-) Length = 364 Score = 42.7 bits (99), Expect = 5e-04 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 8/85 (9%) Frame = +3 Query: 261 ANYTIEQFKHML-GVKPTPPG----LLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKI 425 A+ ++ ++K + G P PP + + R KT + LPK D W + ++ Sbjct: 98 ADLSLHEYKEVCHGADPRPPRNHVFMTSSDRYKTSA-DDVLPKSVD----WRNEGAVTEV 152 Query: 426 LDQGHCGSCWAF---GAVECLQIVL 491 DQGHC SCWAF GAVE L ++ Sbjct: 153 KDQGHCRSCWAFSTVGAVEGLNKIV 177
>CPR2_ARATH (Q9LXW3) Probable cysteine proteinase At3g43960 precursor (EC| 3.4.22.-) Length = 376 Score = 42.4 bits (98), Expect = 7e-04 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 4/95 (4%) Frame = +3 Query: 201 IQTVNNHPNAGWTAGHNPYLANYTIEQFK-HMLGVKPTPPGLLAGVRTKTHPRSEQLPKE 377 I+ N+ PN + G N + ++ T ++F+ LG K L + + LP E Sbjct: 72 IEEHNSDPNRSYERGLNKF-SDLTADEFQASYLGGKMEKKSLSDVAERYQYKEGDVLPDE 130 Query: 378 FDARSKWSGCSTIGKILDQGHCGSCWAF---GAVE 473 D R + + + ++ QG CGSCWAF GAVE Sbjct: 131 VDWRERGA---VVPRVKRQGECGSCWAFAATGAVE 162
>CATB3_GIALA (P92133) Cathepsin B-like CP3 precursor (EC 3.4.22.-) (Cathepsin| B-like protease B3) Length = 299 Score = 42.0 bits (97), Expect = 0.001 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +3 Query: 363 QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 Q P FD R ++ C I +++DQG CGSCWAF +V Sbjct: 73 QAPDSFDFREEYPHC--IPEVVDQGGCGSCWAFSSV 106
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 41.6 bits (96), Expect = 0.001 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = +3 Query: 231 GWTAGHNPYLANYTIEQFKHM-LGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGC 407 G+ G N + A+ T +F+ LG P G G + H E LP D R K + Sbjct: 111 GFRLGMNRF-ADLTNGEFRATYLGTTPAGRGRRVGEAYR-HDGVEALPDSVDWRDKGA-- 166 Query: 408 STIGKILDQGHCGSCWAFGAVECLQ 482 + + +QG CGSCWAF AV ++ Sbjct: 167 -VVAPVKNQGQCGSCWAFSAVAAVE 190
>CATL_DROME (Q95029) Cathepsin L precursor (EC 3.4.22.15) (Cysteine proteinase| 1) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 341 Score = 41.6 bits (96), Expect = 0.001 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P LPK D R+K + + DQGHCGSCWAF + L+ Sbjct: 119 PAHVTLPKSVDWRTK----GAVTAVKDQGHCGSCWAFSSTGALE 158
>CATS_SAIBB (Q8HY82) Cathepsin S precursor (EC 3.4.22.27)| Length = 330 Score = 41.6 bits (96), Expect = 0.001 Identities = 26/79 (32%), Positives = 40/79 (50%) Frame = +3 Query: 255 YLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQ 434 +L + T E+ ++ P + K++P ++ LP D R K GC T ++ Q Sbjct: 79 HLGDMTSEEVMSLMSSLRVPNQWQRNITYKSNP-NQMLPDSVDWREK--GCVT--EVKYQ 133 Query: 435 GHCGSCWAFGAVECLQIVL 491 G CG+CWAF AV L+ L Sbjct: 134 GSCGACWAFSAVGALEAQL 152
>CATL_MOUSE (P06797) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (p39 cysteine proteinase) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 41.6 bits (96), Expect = 0.001 Identities = 21/44 (47%), Positives = 26/44 (59%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P ++PK D R K GC T + +QG CGSCWAF A CL+ Sbjct: 109 PLMLKIPKSVDWREK--GCVT--PVKNQGQCGSCWAFSASGCLE 148
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 40.8 bits (94), Expect = 0.002 Identities = 18/42 (42%), Positives = 26/42 (61%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 +E LP+ D R+K + +I DQG CGSCWAF A+ ++ Sbjct: 126 NEALPESVDWRTK----GAVAEIKDQGGCGSCWAFSAIAAVE 163
>XCP1_ARATH (O65493) Xylem cysteine proteinase 1 precursor (EC 3.4.22.-)| (AtXCP1) Length = 355 Score = 40.4 bits (93), Expect = 0.003 Identities = 32/92 (34%), Positives = 42/92 (45%), Gaps = 2/92 (2%) Frame = +3 Query: 213 NNHPNAGWTAGHNPYLANYTIEQFK-HMLGV-KPTPPGLLAGVRTKTHPRSEQLPKEFDA 386 NN N+ W G N + A+ T E+FK LG+ KP + LPK D Sbjct: 86 NNEINSYWL-GLNEF-ADLTHEEFKGRYLGLAKPQFSRKRQPSANFRYRDITDLPKSVDW 143 Query: 387 RSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 R K + + DQG CGSCWAF V ++ Sbjct: 144 RKK----GAVAPVKDQGQCGSCWAFSTVAAVE 171
>CPR1_DROME (Q9VN93) Putative cysteine proteinase CG12163 precursor (EC| 3.4.22.-) Length = 614 Score = 40.4 bits (93), Expect = 0.003 Identities = 27/80 (33%), Positives = 37/80 (46%), Gaps = 4/80 (5%) Frame = +3 Query: 261 ANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSE-QLPKEFDARSKWSGCSTIGKILDQG 437 A+ T ++K G+ G P +LPKEFD R K + ++ +QG Sbjct: 358 ADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQK----DAVTQVKNQG 413 Query: 438 HCGSCWAF---GAVECLQIV 488 CGSCWAF G +E L V Sbjct: 414 SCGSCWAFSVTGNIEGLYAV 433
>CRUST_PANBO (Q86GF7) Crustapain precursor (EC 3.4.22.-) (NsCys)| Length = 323 Score = 40.4 bits (93), Expect = 0.003 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 5/56 (8%) Frame = +3 Query: 330 GVRTKTHPRSEQLPKE-----FDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 G+ + HP S LPK A W + + DQG CGSCWAF AV L+ Sbjct: 86 GMTRRRHPLSV-LPKSAPTTPMAADVDWRNKGAVTPVKDQGQCGSCWAFSAVAALE 140
>CYSP_PEA (P25804) Cysteine proteinase 15A precursor (EC 3.4.22.-)| (Turgor-responsive protein 15A) Length = 363 Score = 40.4 bits (93), Expect = 0.003 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 7/111 (6%) Frame = +3 Query: 171 HSLGIIQKGIIQTVNNHPNAGWTAGHN-PYLANYTIEQFKHMLGVKPTPPGLLAGVRTKT 347 + G+ + +I+ H N TA H ++ T +F+ GL +R Sbjct: 67 YRFGVFKSNLIKA-KLHQNRDPTAEHGITKFSDLTASEFRRQF------LGLKKRLRLPA 119 Query: 348 HPR------SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 H + + LP++FD R K + + DQG CGSCWAF L+ Sbjct: 120 HAQKAPILPTTNLPEDFDWREK----GAVTPVKDQGSCGSCWAFSTTGALE 166
>CATS_HUMAN (P25774) Cathepsin S precursor (EC 3.4.22.27)| Length = 331 Score = 40.0 bits (92), Expect = 0.004 Identities = 26/79 (32%), Positives = 39/79 (49%) Frame = +3 Query: 255 YLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQ 434 +L + T E+ ++ P + K++P + LP D R K GC T ++ Q Sbjct: 79 HLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNP-NRILPDSVDWREK--GCVT--EVKYQ 133 Query: 435 GHCGSCWAFGAVECLQIVL 491 G CG+CWAF AV L+ L Sbjct: 134 GSCGACWAFSAVGALEAQL 152
>CYSP1_MAIZE (Q10716) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 371 Score = 39.7 bits (91), Expect = 0.005 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +3 Query: 294 LGVKPTPPGLLAGVRTKTHPR----SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAF 461 LG++ + LL + H ++ LP +FD W +G + +QG CGSCW+F Sbjct: 109 LGLRKSRRALLRELGESAHEAPVLPTDGLPDDFD----WRDHGAVGPVKNQGSCGSCWSF 164 Query: 462 GAVECLQ 482 A L+ Sbjct: 165 SASGALE 171
>CATS_CANFA (Q8HY81) Cathepsin S precursor (EC 3.4.22.27)| Length = 331 Score = 39.3 bits (90), Expect = 0.006 Identities = 26/79 (32%), Positives = 41/79 (51%) Frame = +3 Query: 255 YLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQ 434 +L + T E+ ++G P V +++ +++LP D R K GC T ++ Q Sbjct: 79 HLGDMTGEEVISLMGSLRVPSQWQRNVTYRSNS-NQKLPDSVDWREK--GCVT--EVKYQ 133 Query: 435 GHCGSCWAFGAVECLQIVL 491 G CG+CWAF AV L+ L Sbjct: 134 GSCGACWAFSAVGALEAQL 152
>CPR1_ARATH (Q9LT77) Probable cysteine proteinase At3g19400 precursor (EC| 3.4.22.-) Length = 362 Score = 39.3 bits (90), Expect = 0.006 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +3 Query: 348 HPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 + + LP E D W + + DQG+CGSCWAF AV ++ Sbjct: 124 YKEGDVLPDEVD----WRANGAVVSVKDQGNCGSCWAFSAVGAVE 164
>CATL_SARPE (Q26636) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 339 Score = 38.9 bits (89), Expect = 0.008 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P +PK D W + + DQGHCGSCWAF + L+ Sbjct: 117 PAHVTVPKSVD----WREHGAVTGVKDQGHCGSCWAFSSTGALE 156
>CPR4_ARATH (Q9SUS9) Probable cysteine proteinase At4g11320 precursor (EC| 3.4.22.-) Length = 371 Score = 38.9 bits (89), Expect = 0.008 Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 8/103 (7%) Frame = +3 Query: 207 TVNNHPNAGWTAGHNPYLANYTIEQFKHML-GVKPTPPG----LLAGVRTKTHPRSEQLP 371 T N N + G N + A+ ++ ++ + G P PP + + R KT + LP Sbjct: 88 TNRNAENLSYRLGLNRF-ADLSLHEYGEICHGADPRPPRNHVFMTSSNRYKTSD-GDVLP 145 Query: 372 KEFDARSKWSGCSTIGKILDQGHCGSCWAF---GAVECLQIVL 491 K D W + ++ DQG C SCWAF GAVE L ++ Sbjct: 146 KSVD----WRNEGAVTEVKDQGLCRSCWAFSTVGAVEGLNKIV 184
>RD19A_ARATH (P43296) Cysteine proteinase RD19a precursor (EC 3.4.22.-) (RD19)| Length = 368 Score = 38.9 bits (89), Expect = 0.008 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 +E LP++FD W + + +QG CGSCW+F A L+ Sbjct: 132 TENLPEDFD----WRDHGAVTPVKNQGSCGSCWSFSATGALE 169
>CATL_BRUPA (O17473) Cathepsin L-like precursor (EC 3.4.22.15)| Length = 395 Score = 38.5 bits (88), Expect = 0.010 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 4/79 (5%) Frame = +3 Query: 258 LANYTIEQFKHMLGVKPTPPGLLAGVRTKT----HPRSEQLPKEFDARSKWSGCSTIGKI 425 LA+ T E+F G++ L G R + + +SE+LP + D R+K + + Sbjct: 142 LADLTDEEFMVRNGLRLPNQTDLRGKRQTSEFYRYDKSERLPDQVDWRTK----GAVTPV 197 Query: 426 LDQGHCGSCWAFGAVECLQ 482 +QG CGSC+AF L+ Sbjct: 198 RNQGECGSCYAFATAAALE 216
>RD21A_ARATH (P43297) Cysteine proteinase RD21a precursor (EC 3.4.22.-) (RD21)| Length = 462 Score = 38.5 bits (88), Expect = 0.010 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = +3 Query: 360 EQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAF---GAVE 473 ++LP+ D R K + ++ DQG CGSCWAF GAVE Sbjct: 135 DELPESIDWRKK----GAVAEVKDQGGCGSCWAFSTIGAVE 171
>CYSP2_HAECO (P25793) Cathepsin B-like cysteine proteinase 2 precursor (EC| 3.4.22.-) Length = 342 Score = 38.5 bits (88), Expect = 0.010 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWA 458 +P +D R W C+T I DQ +CGSCWA Sbjct: 87 IPPSYDPRDVWKNCTTF-YIRDQANCGSCWA 116
>CYSP1_HAECO (P19092) Cathepsin B-like cysteine proteinase 1 precursor (EC| 3.4.22.-) Length = 342 Score = 38.5 bits (88), Expect = 0.010 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWA 458 +P +D R W C+T I DQ +CGSCWA Sbjct: 87 IPPSYDPRDVWKNCTTF-YIRDQANCGSCWA 116
>CATV_NPVST (Q91BH1) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 38.5 bits (88), Expect = 0.010 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 S + P+ FD W + + K+ +QG CGSCWAF A+ Sbjct: 123 SARTPESFD----WRKLNKVTKVKEQGVCGSCWAFAAI 156
>CATV_NPVMC (Q8QLK1) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 38.1 bits (87), Expect = 0.013 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P Q P FD W + + + DQG CG+CWAF + L+ Sbjct: 121 PGQRQRPANFD----WRNYNKVTSVKDQGMCGACWAFAGLGALE 160
>ANAN_ANACO (P80884) Ananain precursor (EC 3.4.22.31)| Length = 345 Score = 38.1 bits (87), Expect = 0.013 Identities = 26/104 (25%), Positives = 42/104 (40%), Gaps = 8/104 (7%) Frame = +3 Query: 201 IQTVNNHPNAGWTAG--------HNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPR 356 I+T NN +T G +N ++A YT L +K P V + P+ Sbjct: 68 IETFNNRNGNSYTLGINQFTDMTNNEFVAQYT--GLSLPLNIKREPVVSFDDVDISSVPQ 125 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQIV 488 S W + + +QG CGSCWAF ++ ++ + Sbjct: 126 SID----------WRDSGAVTSVKNQGRCGSCWAFASIATVESI 159
>CYSPL_LYCES (P20721) Low-temperature-induced cysteine proteinase precursor (EC| 3.4.22.-) (Fragment) Length = 346 Score = 38.1 bits (87), Expect = 0.013 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +3 Query: 360 EQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQIV 488 + LP+ D R K + + DQG CGSCWAF AV ++ + Sbjct: 16 DSLPESIDWREK----GVLVGVKDQGSCGSCWAFSAVAAMESI 54
>CATV_NPVAH (Q80LP4) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 37.7 bits (86), Expect = 0.017 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +3 Query: 360 EQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV---ECLQIVLHHH 500 ++LP+ FD W + + + DQG CGSCWA AV E L + H++ Sbjct: 124 DELPQNFD----WRVNNKMTSVKDQGACGSCWAHAAVGTLETLYAIKHNY 169
>CATC_SCHMA (Q26563) Cathepsin C precursor (EC 3.4.22.-)| Length = 454 Score = 37.7 bits (86), Expect = 0.017 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 10/109 (9%) Frame = +3 Query: 186 IQKGIIQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLG-VKP--TPPGLLAGVRTKTHPR 356 I + +N H + W P L+ YTI++ ++ G VK T P +L + P Sbjct: 154 INPSFVGKINAHQKS-WRGEIYPELSKYTIDELRNRAGGVKSMVTRPSVL----NRKTPS 208 Query: 357 SE------QLPKEFDARSKWSGC-STIGKILDQGHCGSCWAFGAVECLQ 482 E LP EFD S G S + I +QG CGSC+A + L+ Sbjct: 209 KELISLTGNLPLEFDWTSPPDGSRSPVTPIRNQGICGSCYASPSAAALE 257
>CATL_SCHMA (Q26534) Cathepsin L precursor (EC 3.4.22.15) (SMCL1)| Length = 319 Score = 37.4 bits (85), Expect = 0.023 Identities = 23/73 (31%), Positives = 30/73 (41%) Frame = +3 Query: 243 GHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGK 422 G PY T E + L P + T +PK FD R K + + Sbjct: 64 GVTPYSDLTTDEFARTHLTASWVVPSSRSNTPTSLGKEVNNIPKNFDWREK----GAVTE 119 Query: 423 ILDQGHCGSCWAF 461 + +QG CGSCWAF Sbjct: 120 VKNQGMCGSCWAF 132
>CATF_HUMAN (Q9UBX1) Cathepsin F precursor (EC 3.4.22.41) (CATSF)| Length = 484 Score = 37.4 bits (85), Expect = 0.023 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAF 461 P E+D RSK + K+ DQG CGSCWAF Sbjct: 272 PPEWDWRSK----GAVTKVKDQGMCGSCWAF 298
>A494_ARATH (P43295) Probable cysteine proteinase A494 precursor (EC 3.4.22.-)| Length = 361 Score = 37.4 bits (85), Expect = 0.023 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 ++ LP+EFD W + + +QG CGSCW+F L+ Sbjct: 129 TQNLPEEFD----WRDRGAVTPVKNQGSCGSCWSFSTTGALE 166
>GCP1_ARATH (Q94B08) Germination-specific cysteine protease 1 precursor (EC| 3.4.22.-) Length = 376 Score = 37.4 bits (85), Expect = 0.023 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 1/90 (1%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLP-KEFDARS 392 ++ NA + G + E K LG + P +A + S + KE Sbjct: 90 DNKNATYKLGLTKFTDLTNDEYRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKEVPETV 149 Query: 393 KWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + I DQG CGSCWAF ++ Sbjct: 150 DWRQKGAVNPIKDQGTCGSCWAFSTTAAVE 179
>CATV_NPVSE (Q9J8B9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 37.4 bits (85), Expect = 0.023 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P Q P FD W + I + DQG CG+CW F ++ L+ Sbjct: 121 PAQRQRPVSFD----WRSMNKITSVKDQGMCGACWRFASLGALE 160
>XCP2_ARATH (Q9LM66) Xylem cysteine proteinase 2 precursor (EC 3.4.22.-)| (AtXCP2) Length = 356 Score = 37.4 bits (85), Expect = 0.023 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 360 EQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 E +PK D R K + ++ +QG CGSCWAF V ++ Sbjct: 136 EAVPKSVDWRKK----GAVAEVKNQGSCGSCWAFSTVAAVE 172
>PAPA1_CARPA (P00784) Papain precursor (EC 3.4.22.2) (Papaya proteinase I) (PPI)| (Allergen Car p 1) Length = 345 Score = 37.4 bits (85), Expect = 0.023 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 4/101 (3%) Frame = +3 Query: 201 IQTVNNHPNAGWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEF 380 I N N+ W G N + A+ + ++FK G +AG T T E++ + Sbjct: 79 IDETNKKNNSYWL-GLNVF-ADMSNDEFKEKY------TGSIAGNYTTTELSYEEVLNDG 130 Query: 381 DARSK----WSGCSTIGKILDQGHCGSCWAFGAVECLQIVL 491 D W + + +QG CGSCWAF AV ++ ++ Sbjct: 131 DVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGII 171
>CATLL_FASHE (Q24940) Cathepsin L-like proteinase precursor (EC 3.4.22.-)| Length = 326 Score = 37.0 bits (84), Expect = 0.030 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 7/111 (6%) Frame = +3 Query: 171 HSLGIIQKGI--IQTVNNHPNAG---WTAGHNPYLANYTIEQFK--HMLGVKPTPPGLLA 329 H I +K + IQ N + G +T G N + + T E+FK ++ + L Sbjct: 39 HRRNIWEKNVKHIQEHNLRHDLGLVTYTLGLNQF-TDMTFEEFKAKYLTEMSRASDILSH 97 Query: 330 GVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 GV + + R+ +P + D W + ++ DQG+CGSCWAF ++ Sbjct: 98 GVPYEANNRA--VPDKID----WRESGYVTEVKDQGNCGSCWAFSTTGTME 142
>CYSP_TRYCR (P25779) Cruzipain precursor (EC 3.4.22.51) (Major cysteine| proteinase) (Cruzaine) Length = 467 Score = 37.0 bits (84), Expect = 0.030 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAF---GAVECLQIVLHH 497 W + + DQG CGSCWAF G VEC + H Sbjct: 129 WRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGH 165
>CATS_BOVIN (P25326) Cathepsin S (EC 3.4.22.27)| Length = 217 Score = 37.0 bits (84), Expect = 0.030 Identities = 20/39 (51%), Positives = 23/39 (58%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 LP D R K GC T ++ QG CGSCWAF AV L+ Sbjct: 1 LPDSMDWREK--GCVT--EVKYQGACGSCWAFSAVGALE 35
>CYSP4_BRANA (P25251) Cysteine proteinase COT44 precursor (EC 3.4.22.-)| (Fragment) Length = 328 Score = 37.0 bits (84), Expect = 0.030 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 6/95 (6%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHM-LGVKPTPPGLLAGVRTKTHPRS-----EQLPKE 377 N+ NA + G + AN T ++++ + LG + P + + S +++P Sbjct: 45 NNKNATYKLGLTIF-ANLTNDEYRSLYLGARTEPVRRITKAKNVNMKYSAAVNVDEVPVT 103 Query: 378 FDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 D R K + I DQG CGSCWAF ++ Sbjct: 104 VDWRQK----GAVNAIKDQGTCGSCWAFSTAAAVE 134
>ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC 3.4.22.16)| Length = 358 Score = 36.6 bits (83), Expect = 0.039 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQIVLH 494 W + + +QGHCGSCW F L+ H Sbjct: 147 WREDGIVSPVKEQGHCGSCWTFSTTGALEAAYH 179
>CATL_CANFA (Q9GL24) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 333 Score = 36.6 bits (83), Expect = 0.039 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P ++PK D R K + + +QG CGSCWAF A L+ Sbjct: 109 PLFAEIPKSVDWREK----GYVTPVKNQGQCGSCWAFSATGALE 148
>ACTN_ACTCH (P00785) Actinidain precursor (EC 3.4.22.14) (Actinidin) (Allergen| Act c 1) Length = 380 Score = 36.6 bits (83), Expect = 0.039 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = +3 Query: 213 NNHPNAGWTAGHNPYLANYTIEQFKHM-LGVKPTPPGLLAGVRTKTHPRSEQ-LPKEFDA 386 N N + G N + A+ T E+F+ LG T V + PR Q LP D Sbjct: 77 NADTNRSYKVGLNQF-ADLTDEEFRSTYLGF--TSGSNKTKVSNRYEPRFGQVLPSYVD- 132 Query: 387 RSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + I QG CG CWAF A+ ++ Sbjct: 133 ---WRSAGAVVDIKSQGECGGCWAFSAIATVE 161
>CYSP_PLAVN (P46102) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 506 Score = 36.2 bits (82), Expect = 0.051 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +3 Query: 354 RSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQIVLHH 497 +S+ P D RSK++ DQG+CGSCWAF A+ + + H Sbjct: 259 KSKDFPDSRDYRSKFNFLPP----KDQGNCGSCWAFAAIGNFEYLYVH 302
>CPP1_ENTHI (Q01957) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 315 Score = 36.2 bits (82), Expect = 0.051 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 363 QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 Q PK D R K + I DQG+CGSC+ FG++ L+ Sbjct: 93 QAPKAVDWRKK----GKVTPIRDQGNCGSCYTFGSIAALE 128
>EURM1_EURMA (P25780) Mite group 1 allergen Eur m 1 precursor (EC 3.4.22.-) (Eur| m I) Length = 321 Score = 35.8 bits (81), Expect = 0.066 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 S LP E D RS T+ I QG CGSCWAF V Sbjct: 106 SVSLPSELDLRS----LRTVTPIRMQGGCGSCWAFSGV 139
>CATV_GVXN (Q9PYY5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 346 Score = 35.4 bits (80), Expect = 0.086 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQIVLH 494 S ++P FD W +++ + Q CGSCWAF AV ++ + H Sbjct: 130 SGKVPDSFD----WRDRNSVTSVKMQKECGSCWAFSAVANIESLYH 171
>CYSEP_RICCO (O65039) Vignain precursor (EC 3.4.22.-) (Cysteine endopeptidase)| Length = 360 Score = 35.4 bits (80), Expect = 0.086 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +3 Query: 330 GVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 G T + + + +P D R K + + DQG CGSCWAF + ++ Sbjct: 114 GNGTFMYEKVDTVPASVDWRKK----GAVTSVKDQGQCGSCWAFSTIVAVE 160
>CATV_NPVHZ (Q8V5U0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 367 Score = 35.4 bits (80), Expect = 0.086 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 363 QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 +LP +D W + + I DQG CGSCWAF A+ Sbjct: 155 RLPDYYD----WRDTNKVTPIKDQGVCGSCWAFVAI 186
>CATL_PIG (Q28944) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 35.4 bits (80), Expect = 0.086 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 363 QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 ++PK D R K + + +QG CGSCWAF A L+ Sbjct: 113 EVPKSVDWREK----GYVTAVKNQGQCGSCWAFSATGALE 148
>CATK_CHICK (Q90686) Cathepsin K precursor (EC 3.4.22.38) (JTAP-1)| Length = 334 Score = 35.4 bits (80), Expect = 0.086 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +3 Query: 336 RTKTHPRSEQLPKEFDARSK----WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 R++ P ++ +R+ W + + DQG CGSCWAF +V L+ Sbjct: 102 RSRPRPNGTLYVPDWSSRAPAAVDWRRKGYVTPVKDQGQCGSCWAFSSVGALE 154
>CATS_MOUSE (O70370) Cathepsin S precursor (EC 3.4.22.27)| Length = 340 Score = 35.4 bits (80), Expect = 0.086 Identities = 19/39 (48%), Positives = 23/39 (58%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 LP D R K GC T ++ QG CG+CWAF AV L+ Sbjct: 123 LPDTVDWREK--GCVT--EVKYQGSCGACWAFSAVGALE 157
>ERVC_TABDI (P83654) Ervatamin-C (EC 3.4.22.-) (ERV-C)| Length = 208 Score = 35.4 bits (80), Expect = 0.086 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQIV 488 LP++ D R K + + +QG CGSCWAF V ++ + Sbjct: 1 LPEQIDWRKK----GAVTPVKNQGSCGSCWAFSTVSTVESI 37
>CYSP_THEAN (P25781) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 441 Score = 35.4 bits (80), Expect = 0.086 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 396 WSGCSTIGKILDQG-HCGSCWAFGAVECLQ 482 W+ + I DQG HCGSCWAF ++ ++ Sbjct: 233 WARTDAVSPIKDQGDHCGSCWAFSSIASVE 262
>CATC_CANFA (O97578) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 435 Score = 35.0 bits (79), Expect = 0.11 Identities = 20/83 (24%), Positives = 35/83 (42%) Frame = +3 Query: 234 WTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCST 413 WTA T+ +G + P + + H +LP +D R+ G + Sbjct: 160 WTATRYIEYETLTLRDMMTRVGGRKIPRPKPTPLTAEIHEEISRLPTSWDWRNV-RGTNF 218 Query: 414 IGKILDQGHCGSCWAFGAVECLQ 482 + + +Q CGSC+AF + L+ Sbjct: 219 VSPVRNQASCGSCYAFASTAMLE 241
>CATS_RAT (Q02765) Cathepsin S precursor (EC 3.4.22.27)| Length = 330 Score = 35.0 bits (79), Expect = 0.11 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 ++ LP D R K GC T K QG CGSCWAF A L+ Sbjct: 110 NQTLPDSVDWREK--GCVTNVKY--QGSCGSCWAFSAEGALE 147
>CYSP5_DICDI (P54640) Cysteine proteinase 5 precursor (EC 3.4.22.-)| Length = 344 Score = 35.0 bits (79), Expect = 0.11 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +3 Query: 261 ANYTIEQFKHM-LGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQG 437 A+ T E++++ LG K L+ K H S K+ W + + +QG Sbjct: 78 ADITNEEYRNTYLGTKFDASSLIGTQEEKVHTNSSAASKD------WRSEGAVTPVKNQG 131 Query: 438 HCGSCWAF 461 CG CW+F Sbjct: 132 QCGGCWSF 139
>ORYC_ORYSA (P25778) Oryzain gamma chain precursor (EC 3.4.22.-)| Length = 362 Score = 35.0 bits (79), Expect = 0.11 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + DQGHCGSCW F L+ Sbjct: 151 WREDGIVSPVKDQGHCGSCWPFSTTGSLE 179
>CYSP2_HOMAM (P25782) Digestive cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 323 Score = 35.0 bits (79), Expect = 0.11 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 348 HPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 +P+ E P+ + W + + DQG CGSCWAF L+ Sbjct: 99 YPKKETGPQATEV--DWRTKGAVTPVKDQGQCGSCWAFSTTGSLE 141
>CATL_BOVIN (P25975) Cathepsin L precursor (EC 3.4.22.15) [Contains: Cathepsin| L heavy chain; Cathepsin L light chain] Length = 334 Score = 35.0 bits (79), Expect = 0.11 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P +PK D W+ + + +QG CGSCWAF A L+ Sbjct: 109 PLLVDVPKSVD----WTKKGYVTPVKNQGQCGSCWAFSATGALE 148
>CATL2_HUMAN (O60911) Cathepsin L2 precursor (EC 3.4.22.43) (Cathepsin V)| (Cathepsin U) Length = 334 Score = 35.0 bits (79), Expect = 0.11 Identities = 26/84 (30%), Positives = 37/84 (44%) Frame = +3 Query: 231 GWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCS 410 G+T N + + T E+F+ M+G V + P LPK D R K Sbjct: 72 GFTMAMNAF-GDMTNEEFRQMMGCFRNQKFRKGKVFRE--PLFLDLPKSVDWRKK----G 124 Query: 411 TIGKILDQGHCGSCWAFGAVECLQ 482 + + +Q CGSCWAF A L+ Sbjct: 125 YVTPVKNQKQCGSCWAFSATGALE 148
>ALEU_ARATH (Q8H166) Thiol protease aleurain precursor (EC 3.4.22.16) (AtALEU)| (Senescence-associated gene product 2) Length = 358 Score = 34.7 bits (78), Expect = 0.15 Identities = 26/94 (27%), Positives = 36/94 (38%), Gaps = 1/94 (1%) Frame = +3 Query: 216 NHPNAGWTAGHNPYLANYTIEQFKHM-LGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARS 392 N + G N + A+ T ++F+ LG L G T LP+ D Sbjct: 94 NKKGLSYKLGVNQF-ADLTWQEFQRTKLGAAQNCSATLKGSHKVTEAA---LPETKD--- 146 Query: 393 KWSGCSTIGKILDQGHCGSCWAFGAVECLQIVLH 494 W + + DQG CGSCW F L+ H Sbjct: 147 -WREDGIVSPVKDQGGCGSCWTFSTTGALEAAYH 179
>CATL_SHEEP (Q10991) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] Length = 217 Score = 34.7 bits (78), Expect = 0.15 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 +PK D W+ + + +QG CGSCWAF A L+ Sbjct: 1 VPKSVD----WTKKGYVTPVKNQGQCGSCWAFSATGALE 35
>CYSP2_LEIPI (Q05094) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-2) Length = 444 Score = 34.7 bits (78), Expect = 0.15 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAV 470 W + + DQG CGSCWAF AV Sbjct: 132 WREKGAVTPVKDQGACGSCWAFSAV 156
>ERVB_TABDI (P60994) Ervatamin-B (EC 3.4.22.-) (ERV-B)| Length = 215 Score = 34.7 bits (78), Expect = 0.15 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQIV 488 LP D RSK + I +Q CGSCWAF AV ++ + Sbjct: 1 LPSFVDWRSK----GAVNSIKNQKQCGSCWAFSAVAAVESI 37
>CATK_RAT (O35186) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 34.7 bits (78), Expect = 0.15 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +3 Query: 255 YLANYTIEQF-KHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILD 431 +L + T E+ + M G++ P + T ++P D R K + + + Sbjct: 77 HLGDMTSEEVVQKMTGLRVPPSRSFSNDTLYTPEWEGRVPDSIDYRKK----GYVTPVKN 132 Query: 432 QGHCGSCWAFGAVECLQ 482 QG CGSCWAF + L+ Sbjct: 133 QGQCGSCWAFSSAGALE 149
>DERF1_DERFA (P16311) Major mite fecal allergen Der f 1 precursor (EC 3.4.22.-)| (Der f I) Length = 321 Score = 34.7 bits (78), Expect = 0.15 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = +3 Query: 357 SEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 S +P E D RS T+ I QG CGSCWAF V Sbjct: 106 SVNVPSELDLRS----LRTVTPIRMQGGCGSCWAFSGV 139
>LMCPB_LEIME (P36400) Cysteine proteinase B precursor (EC 3.4.22.-)| Length = 443 Score = 34.7 bits (78), Expect = 0.15 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAV 470 W + + DQG CGSCWAF AV Sbjct: 132 WREKGAVTPVKDQGACGSCWAFSAV 156
>CATK_PIG (Q9GLE3) Cathepsin K precursor (EC 3.4.22.38)| Length = 330 Score = 34.3 bits (77), Expect = 0.19 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +3 Query: 255 YLANYTIEQF-KHMLGVKPTPPGLLAGVRTKTHPRSE-QLPKEFDARSKWSGCSTIGKIL 428 +L + T E+ + M G+K PP T P E + P D R K + + Sbjct: 78 HLGDMTSEEVVQKMTGLK-VPPSHSRSNDTLYIPDWEGRTPDSIDYRKK----GYVTPVK 132 Query: 429 DQGHCGSCWAFGAVECLQ 482 +QG CGSCWAF +V L+ Sbjct: 133 NQGQCGSCWAFSSVGALE 150
>CYSP_HEMSP (P43156) Thiol protease SEN102 precursor (EC 3.4.22.-)| Length = 360 Score = 34.3 bits (77), Expect = 0.19 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + DQG CGSCWAF + ++ Sbjct: 136 WRAKGAVTGVKDQGQCGSCWAFSTIASVE 164
>CYSEP_VIGMU (P12412) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase) (Sulfhydryl-endopeptidase) (SH-EP) [Contains: Vignain-1; Vignain-2] Length = 362 Score = 34.3 bits (77), Expect = 0.19 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +3 Query: 330 GVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 G T + + +P D R K + + DQG CGSCWAF + ++ Sbjct: 116 GSGTFMYEKVGSVPASVDWRKK----GAVTDVKDQGQCGSCWAFSTIVAVE 162
>CYSEP_PHAVU (P25803) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase EP-C1) Length = 362 Score = 34.3 bits (77), Expect = 0.19 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + DQG CGSCWAF V ++ Sbjct: 134 WRKKGAVTDVKDQGQCGSCWAFSTVVAVE 162
>CATL1_PARTE (Q94714) Cathepsin L1 precursor (EC 3.4.22.15)| Length = 314 Score = 34.3 bits (77), Expect = 0.19 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 423 ILDQGHCGSCWAFGAVECLQI 485 + +QG CGSCWAF AV L+I Sbjct: 126 VKNQGSCGSCWAFSAVGALEI 146
>CATK_RABIT (P43236) Cathepsin K precursor (EC 3.4.22.38) (OC-2 protein)| Length = 329 Score = 34.3 bits (77), Expect = 0.19 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +3 Query: 255 YLANYTIEQF-KHMLGVKPTPPGLLAGVRTKTHPRSE-QLPKEFDARSKWSGCSTIGKIL 428 +L + T E+ + M G+K PP T P E + P D R K + + Sbjct: 77 HLGDMTSEEVVQKMTGLK-VPPSRSHSNDTLYIPDWEGRTPDSIDYRKK----GYVTPVK 131 Query: 429 DQGHCGSCWAFGAVECLQ 482 +QG CGSCWAF +V L+ Sbjct: 132 NQGQCGSCWAFSSVGALE 149
>CATV_NPVRO (Q8B9D5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + + + +QG CG+CWAF + L+ Sbjct: 113 PLEFD----WRRLNKVTSVKNQGMCGACWAFATLASLE 146
>CATV_NPVEP (Q91GE3) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 34.3 bits (77), Expect = 0.19 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + I + +QG CG+CWAF + L+ Sbjct: 113 PLEFD----WRRFNKITSVKNQGMCGACWAFATLASLE 146
>CATV_NPVAC (P25783) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + + + +QG CG+CWAF + L+ Sbjct: 113 PLEFD----WRRLNKVTSVKNQGMCGACWAFATLASLE 146
>PAPA3_CARPA (P10056) Caricain precursor (EC 3.4.22.30) (Papaya proteinase| omega) (Papaya proteinase III) (PPIII) (Papaya peptidase A) Length = 348 Score = 34.3 bits (77), Expect = 0.19 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 LP+ D R K + + QG CGSCWAF AV ++ Sbjct: 133 LPENVDWRKK----GAVTPVRHQGSCGSCWAFSAVATVE 167
>CYSP2_DICDI (P04989) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Prestalk| cathepsin) Length = 376 Score = 34.3 bits (77), Expect = 0.19 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAF 461 PK D R+K + + I DQG CGSCW+F Sbjct: 124 PKSIDWRTK----NAVTPIKDQGQCGSCWSF 150
>CYSP2_MAIZE (Q10717) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 360 Score = 33.9 bits (76), Expect = 0.25 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + +QGHCGSCW F L+ Sbjct: 149 WREDGIVSPVKNQGHCGSCWTFSTTGALE 177
>CYSP1_HORVU (P25249) Cysteine proteinase EP-B 1 precursor (EC 3.4.22.-)| Length = 371 Score = 33.9 bits (76), Expect = 0.25 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 LP D R K + + DQG CGSCWAF V Sbjct: 134 LPPSVDWRQK----GAVTGVKDQGKCGSCWAFSTV 164
>CATK_MOUSE (P55097) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 33.9 bits (76), Expect = 0.25 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +3 Query: 255 YLANYTIEQF-KHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILD 431 +L + T E+ + M G++ P + T ++P D R K + + + Sbjct: 77 HLGDMTSEEVVQKMTGLRIPPSRSYSNDTLYTPEWEGRVPDSIDYRKK----GYVTPVKN 132 Query: 432 QGHCGSCWAFGAVECLQ 482 QG CGSCWAF + L+ Sbjct: 133 QGQCGSCWAFSSAGALE 149
>CYSP2_HORVU (P25250) Cysteine proteinase EP-B 2 precursor (EC 3.4.22.-)| Length = 373 Score = 33.9 bits (76), Expect = 0.25 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 LP D R K + + DQG CGSCWAF V Sbjct: 134 LPPSVDWRQK----GAVTGVKDQGKCGSCWAFSTV 164
>CATL_HUMAN (P07711) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 333 Score = 33.9 bits (76), Expect = 0.25 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +3 Query: 351 PRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P + P+ D R K + + +QG CGSCWAF A L+ Sbjct: 109 PLFYEAPRSVDWREK----GYVTPVKNQGQCGSCWAFSATGALE 148
>CATV_NPVHC (Q9WGE0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 33.9 bits (76), Expect = 0.25 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + + + +QG CG+CWAF + L+ Sbjct: 114 PLEFD----WRRLNKVTSVKNQGICGACWAFATLASLE 147
>CATV_NPVCF (P41715) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 33.9 bits (76), Expect = 0.25 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + + + +QG CG+CWAF + L+ Sbjct: 114 PLEFD----WRRLNKVTSVKNQGMCGACWAFATLGSLE 147
>CATV_NPVCD (O41479) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 33.9 bits (76), Expect = 0.25 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + + + +QG CG+CWAF + L+ Sbjct: 114 PLEFD----WRRLNKVTSVKNQGMCGACWAFATLGSLE 147
>CATV_NPVBM (P41721) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 323 Score = 33.9 bits (76), Expect = 0.25 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + + + +QG CG+CWAF + L+ Sbjct: 113 PLEFD----WRRLNKVTSVKNQGMCGACWAFATLGSLE 146
>CATV_NPVAP (Q91CL9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 33.9 bits (76), Expect = 0.25 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + + + +QG CG+CWAF + L+ Sbjct: 114 PLEFD----WRRLNKVTSVKNQGMCGACWAFATLGSLE 147
>CYSP_PLAVS (P42666) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 583 Score = 33.9 bits (76), Expect = 0.25 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAF---GAVECLQIVLHH 497 +P+ D R K + + DQG CGSCWAF G VEC+ H+ Sbjct: 339 VPEILDYREK----GIVHEPKDQGLCGSCWAFASVGNVECMYAKEHN 381
>CYSP_THEPA (P22497) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 440 Score = 33.5 bits (75), Expect = 0.33 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAV 470 W S++ + DQ +CG CWAF V Sbjct: 235 WRRSSSVTSVKDQSNCGGCWAFSTV 259
>CPGP1_ZINOF (P82473) Cysteine proteinase GP-I (EC 3.4.22.-)| Length = 221 Score = 33.5 bits (75), Expect = 0.33 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 LP D R K + + +QG CGSCWAF A+ ++ Sbjct: 3 LPDSIDWREK----GAVVPVKNQGGCGSCWAFDAIAAVE 37
>CATW_MOUSE (P56203) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 371 Score = 33.5 bits (75), Expect = 0.33 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = +3 Query: 243 GHNPYLANYTIEQFKHMLGVKPTP---PGLLAGVRTKTHPRSEQLPKEFDARSKWSGCST 413 G P+ ++ T E+F + G + +P P + V + T E +P+ D R + Sbjct: 85 GETPF-SDLTEEEFGQLYGQERSPERTPNMTKKVESNTW--GESVPRTCDWRK---AKNI 138 Query: 414 IGKILDQGHCGSCWAFGAVECLQ 482 I + +QG C CWA A + +Q Sbjct: 139 ISSVKNQGSCKCCWAMAAADNIQ 161
>CATL_CHICK (P09648) Cathepsin L (EC 3.4.22.15) [Contains: Cathepsin L heavy| chain; Cathepsin L light chain] (Fragments) Length = 218 Score = 33.5 bits (75), Expect = 0.33 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P+ D R K + + DQG CGSCWAF L+ Sbjct: 2 PRSVDWREK----GYVTPVKDQGQCGSCWAFSTTGALE 35
>MDO1_PSEMR (P83443) Macrodontain-1 (EC 3.4.22.-) (Macrodontain I)| Length = 213 Score = 33.5 bits (75), Expect = 0.33 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + ++ +QG CG CWAF A+ ++ Sbjct: 8 WRDYGAVNEVKNQGPCGGCWAFAAIATVE 36
>CYSP1_HOMAM (P13277) Digestive cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 322 Score = 33.5 bits (75), Expect = 0.33 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +3 Query: 261 ANYTIEQFKHML-GVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQG 437 ++ T E+F ++ G K P T P S ++ W + + DQG Sbjct: 73 SDMTNEKFNAVMKGYKKGPRPAAVFTSTDAAPESTEVD--------WRTKGAVTPVKDQG 124 Query: 438 HCGSCWAF 461 CGSCWAF Sbjct: 125 QCGSCWAF 132
>CATB_COTJA (P81494) Cathepsin B (EC 3.4.22.1) (Cathepsin B1) (Fragments)| Length = 48 Score = 33.5 bits (75), Expect = 0.33 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQG 437 LP FD+R +W C TI +I DQG Sbjct: 1 LPDTFDSRKQWPNCPTISEIRDQG 24
>DERP1_DERPT (P08176) Major mite fecal allergen Der p 1 precursor (EC 3.4.22.-)| (Der p I) Length = 320 Score = 33.1 bits (74), Expect = 0.43 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 15/52 (28%) Frame = +3 Query: 360 EQLPKEFDARSKWSGCS---------------TIGKILDQGHCGSCWAFGAV 470 E L +FD ++ + CS T+ I QG CGSCWAF V Sbjct: 87 EHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGV 138
>CATV_NPVOP (O10364) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 33.1 bits (74), Expect = 0.43 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P EFD W + + + +QG CG+CWAF + L+ Sbjct: 114 PLEFD----WRQFNKVTSVKNQGVCGACWAFATLGSLE 147
>CPGP2_ZINOF (P82474) Cysteine proteinase GP-II (EC 3.4.22.-)| Length = 221 Score = 32.7 bits (73), Expect = 0.56 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 360 EQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 + LP D W + + +QG CGSCWAF V ++ Sbjct: 1 DDLPDSID----WRENGAVVPVKNQGGCGSCWAFSTVAAVE 37
>CATK_MACMU (P61277) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 32.7 bits (73), Expect = 0.56 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P D R K + + +QG CGSCWAF +V L+ Sbjct: 116 PDSVDYRKK----GYVTPVKNQGQCGSCWAFSSVGALE 149
>CATK_MACFA (P61276) Cathepsin K precursor (EC 3.4.22.38)| Length = 329 Score = 32.7 bits (73), Expect = 0.56 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P D R K + + +QG CGSCWAF +V L+ Sbjct: 116 PDSVDYRKK----GYVTPVKNQGQCGSCWAFSSVGALE 149
>CATK_HUMAN (P43235) Cathepsin K precursor (EC 3.4.22.38) (Cathepsin O)| (Cathepsin X) (Cathepsin O2) Length = 329 Score = 32.7 bits (73), Expect = 0.56 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P D R K + + +QG CGSCWAF +V L+ Sbjct: 116 PDSVDYRKK----GYVTPVKNQGQCGSCWAFSSVGALE 149
>PAPA2_CARPA (P14080) Chymopapain precursor (EC 3.4.22.6) (Papaya proteinase II)| (PPII) Length = 352 Score = 32.7 bits (73), Expect = 0.56 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 345 THPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 T+ P+ D R+K + + +QG CGSCWAF + ++ Sbjct: 128 TYKHVTNYPQSIDWRAK----GAVTPVKNQGACGSCWAFSTIATVE 169
>CATJ_RAT (Q63088) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 32.7 bits (73), Expect = 0.56 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + +QG CGSCWAF AV ++ Sbjct: 120 WRKEGYVTPVRNQGKCGSCWAFAAVGAIE 148
>CATF_MOUSE (Q9R013) Cathepsin F precursor (EC 3.4.22.41)| Length = 462 Score = 32.3 bits (72), Expect = 0.73 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAF 461 P E+D R K + ++ +QG CGSCWAF Sbjct: 250 PPEWDWRKK----GAVTEVKNQGMCGSCWAF 276
>CYSP3_HOMAM (P25784) Digestive cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 321 Score = 32.3 bits (72), Expect = 0.73 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + + DQ CGSCWAF A L+ Sbjct: 112 WRTKALVTPVKDQEQCGSCWAFSATGALE 140
>LMCPA_LEIME (P25775) Cysteine proteinase A precursor (EC 3.4.22.-)| Length = 354 Score = 32.3 bits (72), Expect = 0.73 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAV 470 W + + +QG CGSCWAF A+ Sbjct: 135 WRDKGAVTPVKNQGLCGSCWAFSAI 159
>CYSP1_LEIPI (P35591) Cysteine proteinase 1 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-1) Length = 354 Score = 32.3 bits (72), Expect = 0.73 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAV 470 W + + +QG CGSCWAF A+ Sbjct: 135 WRDKGAVTPVKNQGLCGSCWAFSAI 159
>CATQ_RAT (Q9QZE3) Cathepsin Q precursor (EC 3.4.22.-)| Length = 343 Score = 32.0 bits (71), Expect = 0.95 Identities = 28/83 (33%), Positives = 35/83 (42%), Gaps = 12/83 (14%) Frame = +3 Query: 261 ANYTIEQFKHM-----LGVKPTPPGLLAGVRTKTHPRS----EQLPKEFDARSKWSGCST 413 A+ T E+FK M L V T L P S + LPK D W Sbjct: 81 ADMTDEEFKDMIIGFQLPVHNTEKRLWKRALGSFFPNSWNWRDALPKFVD----WRNEGY 136 Query: 414 IGKILDQGHCGSCWAF---GAVE 473 + ++ QG C SCWAF GA+E Sbjct: 137 VTRVRKQGGCSSCWAFPVTGAIE 159
>CATM_MOUSE (Q9JL96) Cathepsin M precursor (EC 3.4.22.-)| Length = 333 Score = 32.0 bits (71), Expect = 0.95 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = +3 Query: 231 GWTAGHNPYLANYTIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCS 410 G+T N + + T+E+F+ ++ P P + ++ S LPK + W Sbjct: 72 GFTMEMNAF-GDMTLEEFRKVMIEIPVPT--VKKGKSVQKRLSVNLPKFIN----WKKRG 124 Query: 411 TIGKILDQGHCGSCWAF---GAVE 473 + + QG C SCWAF GA+E Sbjct: 125 YVTPVQTQGRCNSCWAFSVTGAIE 148
>CYSP_PLAFA (P25805) Trophozoite cysteine proteinase precursor (EC 3.4.22.-)| (TCP) Length = 569 Score = 32.0 bits (71), Expect = 0.95 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 363 QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQIV 488 ++P+ D R K + + DQG CGSCWAF +V ++ V Sbjct: 332 KVPEILDYREK----GIVHEPKDQGLCGSCWAFASVGNIESV 369
>CYSP3_CARCN (P32956) Cysteine proteinase 3 (EC 3.4.22.-) (Cysteine proteinase| III) (CC-III) (Fragment) Length = 43 Score = 32.0 bits (71), Expect = 0.95 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P+ D R K + + +QG CGSCWAF + ++ Sbjct: 2 PESIDWRKK----GAVTPVKNQGSCGSCWAFSTIATVE 35
>CATO_MOUSE (Q8BM88) Cathepsin O precursor (EC 3.4.22.42)| Length = 312 Score = 31.6 bits (70), Expect = 1.2 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 LP FD R K + + +Q CG CWAF V ++ Sbjct: 99 LPLRFDWRDK----HVVNPVRNQEMCGGCWAFSVVSAIE 133
>CPP3_ENTHI (Q06964) Cysteine proteinase 3 precursor (EC 3.4.22.-) (Cysteine| proteinase ACP3) (Fragment) Length = 308 Score = 31.6 bits (70), Expect = 1.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 363 QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 Q P+ D W + I DQ CGSC+ FG++ L+ Sbjct: 86 QAPESVD----WRAQGKVTPIRDQAQCGSCYTFGSLAALE 121
>ALEU_HORVU (P05167) Thiol protease aleurain precursor (EC 3.4.22.16)| Length = 362 Score = 31.6 bits (70), Expect = 1.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + +Q HCGSCW F L+ Sbjct: 150 WREDGIVSPVKNQAHCGSCWTFSTTGALE 178
>CATJ_MOUSE (Q9R014) Cathepsin J precursor (EC 3.4.22.-) (Cathepsin P)| (Cathepsin L-related protein) (Catlrp-p) Length = 334 Score = 31.6 bits (70), Expect = 1.2 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 5/76 (6%) Frame = +3 Query: 270 TIEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQ-----LPKEFDARSKWSGCSTIGKILDQ 434 T E+F+ + P P + T P ++ LP D W + + +Q Sbjct: 84 TSEEFRKSIDNIPIPAAM-------TDPHAQNHVSIGLPDYKD----WREEGYVTPVRNQ 132 Query: 435 GHCGSCWAFGAVECLQ 482 G CGSCWAF A ++ Sbjct: 133 GKCGSCWAFAAAGAIE 148
>BROM1_ANACO (O23791) Bromelain precursor (EC 3.4.22.32) (Allergen Ana c 2)| Length = 351 Score = 31.6 bits (70), Expect = 1.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + ++ +Q CGSCW+F A+ ++ Sbjct: 129 WRDYGAVNEVKNQNPCGSCWSFAAIATVE 157
>CYSP4_CARCN (P32957) Cysteine proteinase 4 (EC 3.4.22.-) (Cysteine proteinase| IV) (CC-IV) (Fragment) Length = 43 Score = 31.6 bits (70), Expect = 1.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAV 470 P+ D R K + + +QG CGSCWAF + Sbjct: 2 PESIDWRKK----GAVTPVKNQGSCGSCWAFSTI 31
>CYSP1_CARCN (P32954) Cysteine proteinase 1 (EC 3.4.22.-) (Cysteine proteinase| I) (CC-I) (Fragment) Length = 43 Score = 31.6 bits (70), Expect = 1.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQIVL 491 W + + +QG CGSCW F +V ++ ++ Sbjct: 7 WRQKGAVTPVRNQGSCGSCWTFSSVAAVEGII 38
>CYSP7_DICDI (Q94504) Cysteine proteinase 7 precursor (EC 3.4.22.-) (Proteinase| 1) Length = 460 Score = 31.2 bits (69), Expect = 1.6 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Frame = +3 Query: 372 KEFDARSK--WSGCSTIGKILDQGHCGSCWAF---GAVECLQ 482 K FDA ++ W + I +QG CG CW+F GA E Q Sbjct: 106 KIFDASAQVDWRTQGAVTPIKNQGQCGGCWSFSTTGATEGAQ 147
>CATV_NPVLD (Q9YMP9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 356 Score = 31.2 bits (69), Expect = 1.6 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECL--QIVLHHH 500 P FD W + + I +QG CG+CWAF + + Q + H+ Sbjct: 145 PLHFD----WREQNKVTSIKNQGACGACWAFATLASVESQFAMRHN 186
>TEST2_RAT (P15242) Testin 2 precursor (CMB-23) [Contains: Testin 1 (CMB-22)]| Length = 333 Score = 31.2 bits (69), Expect = 1.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 +PK D W + + +QGHC S WAF A L+ Sbjct: 114 VPKRVD----WRQLGYVTPVKNQGHCASSWAFSATGSLE 148
>PAPA4_CARPA (P05994) Papaya proteinase 4 precursor (EC 3.4.22.25) (Papaya| proteinase IV) (PPIV) (Papaya peptidase B) (Glycyl endopeptidase) Length = 348 Score = 31.2 bits (69), Expect = 1.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 LP+ D R+K + + QG+C SCWAF V ++ Sbjct: 133 LPESVDWRAK----GAVTPVKHQGYCESCWAFSTVATVE 167
>CYSP2_CARCN (P32955) Cysteine proteinase 2 (EC 3.4.22.-) (Cysteine proteinase| II) (CC-II) (Fragment) Length = 43 Score = 31.2 bits (69), Expect = 1.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + DQ CGSCWAF V ++ Sbjct: 7 WRQKGAVTPVKDQNPCGSCWAFSTVATVE 35
>BROM2_ANACO (P14518) Bromelain, stem (EC 3.4.22.32)| Length = 212 Score = 30.8 bits (68), Expect = 2.1 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQIV 488 W + + +Q CG+CWAF A+ ++ + Sbjct: 8 WRDYGAVTSVKNQNPCGACWAFAAIATVESI 38
>CYSP1_DICDI (P04988) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 343 Score = 30.8 bits (68), Expect = 2.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAF 461 +P FD R++ + + +QG CGSCW+F Sbjct: 118 IPTAFDWRTR----GAVTPVKNQGQCGSCWSF 145
>CATC_MACFA (Q60HG6) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 463 Score = 30.8 bits (68), Expect = 2.1 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = +3 Query: 303 KPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 +P P L A ++ K LP +D R+ G + + + +Q CGSC++F +V L+ Sbjct: 214 RPKPTPLTAEIQQKIL----HLPTSWDWRNV-HGINFVSPVRNQASCGSCYSFASVGMLE 268
>CATO_HUMAN (P43234) Cathepsin O precursor (EC 3.4.22.42)| Length = 321 Score = 30.8 bits (68), Expect = 2.1 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +3 Query: 366 LPKEFDARSKWSGCSTIGKILDQGHCGSCWAF---GAVE 473 LP FD R K + ++ +Q CG CWAF GAVE Sbjct: 108 LPLRFDWRDK----QVVTQVRNQQMCGGCWAFSVVGAVE 142
>NPAS2_HUMAN (Q99743) Neuronal PAS domain protein 2 (Neuronal PAS2) (Member of| PAS protein 4) (MOP4) Length = 824 Score = 30.4 bits (67), Expect = 2.8 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 8/77 (10%) Frame = +3 Query: 171 HSLGIIQKGIIQTVNNHPNA------GWTAGHNPYLANYTIEQFKHMLGVKPT--PPGLL 326 HS + KG H NA G H+P ++ + + H +PT P L+ Sbjct: 375 HSSALKDKGSSLEPRQHFNALDVGASGLNTSHSPSASSRSSHKSSHTAMSEPTSTPTKLM 434 Query: 327 AGVRTKTHPRSEQLPKE 377 A T PRS LP+E Sbjct: 435 AEASTPALPRSATLPQE 451
>CYSP3_LYCES (Q40143) Cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 356 Score = 30.4 bits (67), Expect = 2.8 Identities = 24/91 (26%), Positives = 35/91 (38%), Gaps = 1/91 (1%) Frame = +3 Query: 213 NNHPNAGWTAGHNPYLANYTIEQF-KHMLGVKPTPPGLLAGVRTKTHPRSEQLPKEFDAR 389 +N + G N + + T ++F KH LG G T+ LP+ D Sbjct: 91 HNRKGLSYKLGINEF-TDLTWDEFRKHKLGASQNCSATTKGNLKLTNV---VLPETKD-- 144 Query: 390 SKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + QG CGSCW F L+ Sbjct: 145 --WRKDGIVSPVKAQGKCGSCWTFSTTGALE 173
>CPP2_ENTHI (Q01958) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 315 Score = 30.4 bits (67), Expect = 2.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 363 QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 Q P+ D W + I DQ CGSC+ FG++ L+ Sbjct: 93 QAPESVD----WRKEGKVTPIRDQAQCGSCYTFGSLAALE 128
>CATLL_PHACE (O97397) Cathepsin L-like proteinase precursor (EC 3.4.22.-)| Length = 324 Score = 30.4 bits (67), Expect = 2.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P+ D RSK + + +QG CGSCWA ++ Sbjct: 111 PESIDWRSK----GVVLPVRNQGECGSCWALSTAAAIE 144
>CATH_RAT (P00786) Cathepsin H precursor (EC 3.4.22.16) (Cathepsin B3)| (Cathepsin BA) [Contains: Cathepsin H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 333 Score = 30.4 bits (67), Expect = 2.8 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P D R K + + + +QG CGSCW F L+ Sbjct: 115 PSSMDWRKKGN---VVSPVKNQGACGSCWTFSTTGALE 149
>ACVL1_PONPY (Q5RAN0) Serine/threonine-protein kinase receptor R3 precursor (EC| 2.7.11.30) (SKR3) (Activin receptor-like kinase 1) (ALK-1) Length = 503 Score = 30.0 bits (66), Expect = 3.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 358 QSSSQRSSTPGRNGPVAAQLGKYLIKVTAVPVGLLELWSVCR 483 +++ S PG +G +A LG L + V +G+L LW V R Sbjct: 104 EATQSPSEQPGTDGQLALILGPVLALLALVALGVLGLWHVRR 145
>MEX1_JACME (P84346) Mexicain (EC 3.4.22.-)| Length = 214 Score = 30.0 bits (66), Expect = 3.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P+ D R K + + +Q CGSCWAF V ++ Sbjct: 2 PESIDWREK----GAVTPVKNQNPCGSCWAFSTVATIE 35
>CYSP_TRYBB (P14658) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 450 Score = 30.0 bits (66), Expect = 3.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAV 470 W + + QG CGSCWAF + Sbjct: 132 WREKGAVTPVKVQGQCGSCWAFSTI 156
>ACP2_ENTHI (P36185) Cysteine proteinase ACP2 precursor (EC 3.4.22.-)| (Fragment) Length = 310 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 363 QLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 Q P+ D W + + DQ CGSC+ FG++ L+ Sbjct: 89 QAPESVD----WRKEGKVTPLRDQAQCGSCYTFGSLAALE 124
>MEX2_JACME (P84347) Chymomexicain (EC 3.4.22.-)| Length = 215 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 W + + +Q CGSCWAF V ++ Sbjct: 7 WRDKGAVTPVKNQNPCGSCWAFSTVATVE 35
>CATC_HUMAN (P53634) Dipeptidyl-peptidase 1 precursor (EC 3.4.14.1)| (Dipeptidyl-peptidase I) (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase 1 exclusion domain chain (Dipeptidyl-peptidase I exclusion dom Length = 463 Score = 29.6 bits (65), Expect = 4.7 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +3 Query: 303 KPTPPGLLAGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 +P P L A ++ K LP +D R+ G + + + +Q CGSC++F ++ L+ Sbjct: 214 RPKPAPLTAEIQQKIL----HLPTSWDWRNV-HGINFVSPVRNQASCGSCYSFASMGMLE 268
>CATV_GVCP (O91466) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 333 Score = 29.6 bits (65), Expect = 4.7 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 4/63 (6%) Frame = +3 Query: 294 LGVKPTPPGLL----AGVRTKTHPRSEQLPKEFDARSKWSGCSTIGKILDQGHCGSCWAF 461 LG+K P + V K P++ LP+ D R K + + +Q CGSCWAF Sbjct: 97 LGLKKNPSAFTMTECSVVVIKDEPQA-LLPETLDWRDKHG----VTPVKNQMECGSCWAF 151 Query: 462 GAV 470 + Sbjct: 152 STI 154
>ACVL1_HUMAN (P37023) Serine/threonine-protein kinase receptor R3 precursor (EC| 2.7.11.30) (SKR3) (Activin receptor-like kinase 1) (ALK-1) (TGF-B superfamily receptor type I) (TSR-I) Length = 503 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 358 QSSSQRSSTPGRNGPVAAQLGKYLIKVTAVPVGLLELWSVCR 483 +++ S PG +G +A LG L + V +G+L LW V R Sbjct: 104 EATQPPSEQPGTDGQLALILGPVLALLALVALGVLGLWHVRR 145
>CATH_PIG (O46427) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P D R K + + + +QG CGSCW F L+ Sbjct: 117 PPSMDWRKKGN---FVSPVKNQGSCGSCWTFSTTGALE 151
>CP21A_PIG (P15540) Cytochrome P450 21 (EC 1.14.99.10) (Cytochrome P450 XXI)| (Steroid 21-hydroxylase) (21-OHase) (P450-C21) (P-450c21) Length = 492 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 303 KPTPPGLLAGVRTKTHPRSEQLPKEFDARSK 395 K T LL GVR+ PR EQL +EF R + Sbjct: 122 KLTRSALLLGVRSSMEPRVEQLTQEFCERMR 152
>FPRA_MYCTU (O05783) NADPH-ferredoxin reductase fprA (EC 1.18.1.2) (NFR)| Length = 456 Score = 28.9 bits (63), Expect = 8.1 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 7/86 (8%) Frame = +3 Query: 201 IQTVNNHPNAGWTAGHNPYLANYT--IEQFKHMLGVKPTPPGLLAGVRTKTHPRSEQLPK 374 I V + P+A + A A+ T ++ ML + PTP GL+ HP+ + + K Sbjct: 6 IAIVGSGPSAFFAAASLLKAADTTEDLDMAVDMLEMLPTPWGLVRSGVAPDHPKIKSISK 65 Query: 375 EF-----DARSKWSGCSTIGKILDQG 437 +F D R ++ G +G+ + G Sbjct: 66 QFEKTAEDPRFRFFGNVVVGEHVQPG 91
>ACP1_ENTHI (P36184) Cysteine proteinase ACP1 precursor (EC 3.4.22.-)| Length = 308 Score = 28.9 bits (63), Expect = 8.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 429 DQGHCGSCWAFGAVECLQ 482 DQG CGSCW F L+ Sbjct: 108 DQGQCGSCWTFCTTAVLE 125
>CYSP4_DICDI (P54639) Cysteine proteinase 4 precursor (EC 3.4.22.-)| Length = 442 Score = 28.9 bits (63), Expect = 8.1 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 396 WSGCSTIGKILDQGHCGSCWAF 461 W + I +QG CG CW+F Sbjct: 117 WRAQGAVTPIKNQGQCGGCWSF 138
>CATZ_RAT (Q9R1T3) Cathepsin Z precursor (EC 3.4.22.-) (Cathepsin Y)| Length = 306 Score = 28.9 bits (63), Expect = 8.1 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 9/61 (14%) Frame = +3 Query: 324 LAGVRTKTHPRSEQ------LPKEFDARSKWSGCSTIGKILDQG---HCGSCWAFGAVEC 476 LA + +T+PR + LPK +D R+ +G + +Q +CGSCWA G+ Sbjct: 44 LALLGRRTYPRPHEYLSPADLPKNWDWRNV-NGVNYASVTRNQHIPQYCGSCWAHGSTSA 102 Query: 477 L 479 L Sbjct: 103 L 103
>CATH_HUMAN (P09668) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 28.9 bits (63), Expect = 8.1 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 369 PKEFDARSKWSGCSTIGKILDQGHCGSCWAFGAVECLQ 482 P D R K + + + +QG CGSCW F L+ Sbjct: 117 PPSVDWRKKGN---FVSPVKNQGACGSCWTFSTTGALE 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,918,035 Number of Sequences: 219361 Number of extensions: 1247786 Number of successful extensions: 4165 Number of sequences better than 10.0: 170 Number of HSP's better than 10.0 without gapping: 4044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4155 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
