| Clone Name | baet69g06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IND_ARATH (O81313) INDEHISCENT protein | 32 | 0.91 | 2 | ERYA3_SACER (Q03133) Erythronolide synthase, modules 5 and 6 (EC... | 28 | 7.7 |
|---|
>IND_ARATH (O81313) INDEHISCENT protein| Length = 169 Score = 31.6 bits (70), Expect = 0.91 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +2 Query: 188 VGRKVRELRRLVPGASVMPTDRLLLRTADYIAQLRARVELLRALSEL 328 + K+R L+R+VPG + M T +L Y L+ +V +L+ S++ Sbjct: 105 ISEKIRILKRIVPGGAKMDTASMLDEAIRYTKFLKRQVRILQPHSQI 151
>ERYA3_SACER (Q03133) Erythronolide synthase, modules 5 and 6 (EC 2.3.1.94) (ORF| 3) (6-deoxyerythronolide B synthase III) (DEBS 3) Length = 3171 Score = 28.5 bits (62), Expect = 7.7 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 9/74 (12%) Frame = -2 Query: 418 PLYVRDIHVYIRHTTGSQLARGVAMAMAFAELRERPEELH---PGPELR------DVVGR 266 PL++ + I HT + GV A+ E P LH P P++ VV + Sbjct: 361 PLWIGSVKSNIGHTQAAAGVAGVMKAVLALRHGEMPRTLHFDEPSPQIEWDLGAVSVVSQ 420 Query: 265 TKEQPVGGHNGRSG 224 + P G R+G Sbjct: 421 ARSWPAGERPRRAG 434 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,221,691 Number of Sequences: 219361 Number of extensions: 664620 Number of successful extensions: 1882 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1882 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)