| Clone Name | baet69b10 |
|---|---|
| Clone Library Name | barley_pub |
>PQQE_METCA (Q608P0) Coenzyme PQQ synthesis protein E (Pyrroloquinoline quinone| biosynthesis protein E) Length = 373 Score = 28.9 bits (63), Expect = 3.3 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 7/71 (9%) Frame = +3 Query: 126 KVLMLCGDYMEDYEAA------VPFYALAGLGVAVHCAAPGKAPGDPCPTAVHDFLGYDL 287 K+ + DY ED A F +A G+A+ C A + PG CP +V DF ++ Sbjct: 226 KIYYVVPDYYEDRPKACMNGWGTTFLTIAPDGMALPCHAARELPGLNCP-SVRDFSIREI 284 Query: 288 YTELPG-HRFR 317 + E +RFR Sbjct: 285 WYESAAFNRFR 295
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 27.7 bits (60), Expect = 7.4 Identities = 21/64 (32%), Positives = 29/64 (45%) Frame = +3 Query: 57 RSYAGTNSASRLRAGPRAMAPSKKVLMLCGDYMEDYEAAVPFYALAGLGVAVHCAAPGKA 236 RS + ++S SR R+ + +K+ + D EAA A A G AAPGK Sbjct: 287 RSPSESSSESRSRSRSPSPGREEKITFITSFGGSDEEAAAAAAAAAASG-----AAPGKP 341 Query: 237 PGDP 248 P P Sbjct: 342 PAPP 345
>ATKA_METCA (Q605R1) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 595 Score = 27.7 bits (60), Expect = 7.4 Identities = 24/81 (29%), Positives = 34/81 (41%) Frame = +3 Query: 36 FASLCSDRSYAGTNSASRLRAGPRAMAPSKKVLMLCGDYMEDYEAAVPFYALAGLGVAVH 215 F+ + S AG N+ S AG A P +++ + Y AVP A+AG A + Sbjct: 486 FSEILYAFSSAGNNNGSAF-AGLAANTPFYNLMLGLAMWFSRYWLAVPVLAIAGALAAKN 544 Query: 216 CAAPGKAPGDPCPTAVHDFLG 278 PG PT F+G Sbjct: 545 YVPPG---AGTLPTHTPMFVG 562
>DLGP4_RAT (P97839) Disks large-associated protein 4 (DAP-4)| (SAP90/PSD-95-associated protein 4) (SAPAP4) (PSD-95/SAP90-binding protein 4) Length = 992 Score = 27.7 bits (60), Expect = 7.4 Identities = 30/111 (27%), Positives = 40/111 (36%), Gaps = 13/111 (11%) Frame = +3 Query: 15 SETKSSCFASLCSDRSYAGTNSASRLRAG----PRAMAPSKKVLMLCGDY-----MEDYE 167 SE S S SD + T S R G P A P K L ++ E + Sbjct: 597 SEVTSQSGLSNSSDSLDSSTRPPSVTRGGITPGPEAPEPPPKHAALKSEHGTLTSSESHS 656 Query: 168 AAVPFYALAGLGVAVHCAAPGKAPGDPCPTAVHDFLGY----DLYTELPGH 308 AVP L+ +G+ V C P +P P +G D + P H Sbjct: 657 EAVPKRKLSSIGIQVDCIQP-VPKEEPSPATKFQSIGVQVEDDWRSSAPSH 706
>HBE_MICMU (Q28496) Hemoglobin epsilon subunit (Hemoglobin epsilon chain)| (Epsilon-globin) Length = 146 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 60 SYAGTNSASRLRAGPRAMAPSKKVLMLCGDYMEDYEAAVPFYA 188 S+ +SAS + P+ A KKVL G+ +++ + P +A Sbjct: 44 SFGNLSSASAIMGNPKVKAHGKKVLTSFGEAVKNLDNLKPAFA 86
>POL5_DROME (Q8I7P9) Retrovirus-related Pol polyprotein from transposon opus| [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1003 Score = 27.3 bits (59), Expect = 9.6 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 8/45 (17%) Frame = +2 Query: 2 VDDLLRNQVFVLCFPLL*PIL--------RWHKLCLTLASWSKSN 112 +DD+LR + +C+ + I+ W L L LAS SK+N Sbjct: 265 IDDILREHIGKVCYVYIDDIIVFSEDYDTHWKNLRLVLASLSKAN 309
>TCF7_MOUSE (Q00417) Transcription factor 7 (T-cell-specific transcription| factor 1) (TCF-1) (T-cell factor 1) Length = 419 Score = 27.3 bits (59), Expect = 9.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 177 PFYALA-GLGVAVHCAAPGKAPGDPCPTAVHDFLGYDLYTELPGH 308 P Y L+ G H AP APG P P H L L + +PGH Sbjct: 220 PLYPLSPSCGYRQHFPAPTAAPGAPYPRFTHPSL--MLGSGVPGH 262
>MOEA_ANASP (Q44243) Molybdopterin biosynthesis protein moeA| Length = 436 Score = 27.3 bits (59), Expect = 9.6 Identities = 20/63 (31%), Positives = 25/63 (39%) Frame = +3 Query: 144 GDYMEDYEAAVPFYALAGLGVAVHCAAPGKAPGDPCPTAVHDFLGYDLYTELPGHRFRVT 323 GDY DY + LA LG +H + PG P A +Y LPG+ V Sbjct: 282 GDY--DYVDQI----LASLGAKIHIRSVEMRPGKPLTVATFPTPPAPIYLGLPGNPAAVL 335 Query: 324 ADF 332 F Sbjct: 336 VTF 338 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,247,259 Number of Sequences: 219361 Number of extensions: 533311 Number of successful extensions: 1871 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1869 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)