| Clone Name | baet67c06 |
|---|---|
| Clone Library Name | barley_pub |
>IF2_THEFY (Q47RV1) Translation initiation factor IF-2| Length = 955 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 236 PVRPGRARPAWASSSSGSRP*DHGTGAGVAPR 141 P PG ARP+ +S S G R G G G PR Sbjct: 259 PTPPGGARPSTSSRSGGGR--GRGGGGGAGPR 288
>MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2386 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 160 PVPWSYGRLPDDDEAQAGRAR 222 P W+Y R PD DE + G AR Sbjct: 605 PARWAYARCPDVDECRLGLAR 625
>MEGF8_MOUSE (P60882) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2330 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 160 PVPWSYGRLPDDDEAQAGRAR 222 P W+Y R PD DE + G AR Sbjct: 605 PARWAYARCPDVDECRLGLAR 625
>SARM1_MOUSE (Q6PDS3) Sterile alpha and TIR motif-containing protein 1 (Tir-1| homolog) Length = 724 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 239 GPVRPGRARPAWASSSSGSRP*DHGTGAGV 150 GP R G A P WA+ GSR G G V Sbjct: 32 GPDRSGGASPWWAAGGRGSREVSPGVGTEV 61
>THYG_RAT (P06882) Thyroglobulin precursor| Length = 2768 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 206 WASSSSGSRP*DHGTGAGVAPRSPA 132 W S GSRP G G G+ P+S A Sbjct: 1820 WKDSDIGSRPESMGCGRGMVPKSEA 1844
>ADCY6_MOUSE (Q01341) Adenylate cyclase type 6 (EC 4.6.1.1) (Adenylate cyclase| type VI) (ATP pyrophosphate-lyase 6) (Ca(2+)-inhibitable adenylyl cyclase) Length = 1165 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 154 PAPVPWSYGRLPDDDEAQAGRARPGR 231 P+P P ++ R P DEA RA PGR Sbjct: 52 PSPTPAAHTRCPWQDEAFIRRAGPGR 77
>POL2_BAMMU (Q65657) Genome polyprotein 2 [Contains: Helper component| proteinase (EC 3.4.22.45) (HC-pro); 70 kDa protein] Length = 894 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -1 Query: 233 VRPGRARPA----WASSSSGSRP*DHGTGAGVAPRSP 135 +RP R R W S SG DH G G +P++P Sbjct: 489 IRPKRLRRKSTFPWVSLDSGDEDDDHSGGGGGSPQTP 525
>RP3A_HUMAN (Q9Y2J0) Rabphilin-3A (Exophilin-1)| Length = 694 Score = 27.3 bits (59), Expect = 9.6 Identities = 20/38 (52%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 236 PVRPGRARPAWASSSS-GSRP*DHGTGAGVAPRSPASI 126 PVR RA A SSSS S DH GAG + RSPA + Sbjct: 232 PVR--RASEARMSSSSRDSESWDHSGGAGDSSRSPAGL 267
>TAF4_HUMAN (O00268) Transcription initiation factor TFIID subunit 4| (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) (TAFII-130) (TAFII130) Length = 1085 Score = 27.3 bits (59), Expect = 9.6 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 133 AGDRGATPA-PVPWSYGRLPDDDEAQAGRARPGRTGP 240 AG GA PA P + G P+ A GRARPG GP Sbjct: 68 AGAAGAGPAAPAEGAPGAAPEPPPA--GRARPGGGGP 102
>EP300_HUMAN (Q09472) E1A-associated protein p300 (EC 2.3.1.48)| Length = 2414 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 136 GDRGATPAPVPWSYGRLPDDDEAQAGRARP 225 G G P PWS G LP + Q+G RP Sbjct: 1985 GPTGMQQQP-PWSQGGLPQPQQLQSGMPRP 2013 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,882,848 Number of Sequences: 219361 Number of extensions: 464832 Number of successful extensions: 1555 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1554 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)