ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet66b12 |
|---|---|
| Clone Library Name | barley_pub |
>CYSP1_MAIZE (Q10716) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 371 Score = 117 bits (292), Expect = 9e-27 Identities = 56/74 (75%), Positives = 64/74 (86%) Frame = +1 Query: 121 EEPLIRQVVGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQ 300 E+PLIRQVV G D D +L +S F+ FVQRFGK+Y+DA+EHA+RLSVFK NLRRARRHQ Sbjct: 24 EDPLIRQVVPGGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKDNLRRARRHQ 83 Query: 301 LLDPSAEHGVTKFS 342 LLDPSAEHGVTKFS Sbjct: 84 LLDPSAEHGVTKFS 97
>RD19A_ARATH (P43296) Cysteine proteinase RD19a precursor (EC 3.4.22.-) (RD19)| Length = 368 Score = 86.3 bits (212), Expect = 2e-17 Identities = 45/74 (60%), Positives = 54/74 (72%) Frame = +1 Query: 121 EEPLIRQVVGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQ 300 ++ +IRQVVGGA+P L + F F ++FGK Y EEH +R SVFKANLRRARRHQ Sbjct: 29 DDLVIRQVVGGAEP--QVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRARRHQ 86 Query: 301 LLDPSAEHGVTKFS 342 LDPSA HGVT+FS Sbjct: 87 KLDPSATHGVTQFS 100
>A494_ARATH (P43295) Probable cysteine proteinase A494 precursor (EC 3.4.22.-)| Length = 361 Score = 81.6 bits (200), Expect = 4e-16 Identities = 43/76 (56%), Positives = 51/76 (67%) Frame = +1 Query: 115 GDEEPLIRQVVGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARR 294 GDE+ LIRQVV +P L + F F ++FGK Y EEH +R SVFKANL RA R Sbjct: 24 GDEDVLIRQVVDETEPKV--LSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAMR 81 Query: 295 HQLLDPSAEHGVTKFS 342 HQ +DPSA HGVT+FS Sbjct: 82 HQKMDPSARHGVTQFS 97
>CYSP_PEA (P25804) Cysteine proteinase 15A precursor (EC 3.4.22.-)| (Turgor-responsive protein 15A) Length = 363 Score = 69.3 bits (168), Expect = 2e-12 Identities = 34/75 (45%), Positives = 49/75 (65%) Frame = +1 Query: 118 DEEPLIRQVVGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRH 297 +++ +IRQVV + D+ L + F F +F K+Y EEH +R VFK+NL +A+ H Sbjct: 25 NDDFIIRQVVDNEE--DHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKSNLIKAKLH 82 Query: 298 QLLDPSAEHGVTKFS 342 Q DP+AEHG+TKFS Sbjct: 83 QNRDPTAEHGITKFS 97
>CYSP_TRYCR (P25779) Cruzipain precursor (EC 3.4.22.51) (Major cysteine| proteinase) (Cruzaine) Length = 467 Score = 53.1 bits (126), Expect = 2e-07 Identities = 28/54 (51%), Positives = 32/54 (59%) Frame = +1 Query: 181 LDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 L SQF F Q+ G+ Y A E A RLSVF+ NL AR H +P A GVT FS Sbjct: 34 LTSQFAEFKQKHGRVYESAAEEAFRLSVFRENLFLARLHAAANPHATFGVTPFS 87
>CATF_HUMAN (Q9UBX1) Cathepsin F precursor (EC 3.4.22.41) (CATSF)| Length = 484 Score = 50.1 bits (118), Expect = 1e-06 Identities = 31/65 (47%), Positives = 41/65 (63%), Gaps = 3/65 (4%) Frame = +1 Query: 157 DPLDYDL--ELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLD-PSAEHG 327 DPL DL ++ S F FV + +TY EE RLSVF N+ RA++ Q LD +A++G Sbjct: 173 DPLSQDLPVKMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGTAQYG 232 Query: 328 VTKFS 342 VTKFS Sbjct: 233 VTKFS 237
>CYSP_TRYBB (P14658) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 450 Score = 48.1 bits (113), Expect = 5e-06 Identities = 22/60 (36%), Positives = 35/60 (58%) Frame = +1 Query: 163 LDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 L + L+ +F F +++GK Y+DA+E A R F+ N+ +A+ +P A GVT FS Sbjct: 31 LHVEESLEMRFAAFKKKYGKVYKDAKEEAFRFRAFEENMEQAKIQAAANPYATFGVTPFS 90
>CATW_HUMAN (P56202) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 376 Score = 47.8 bits (112), Expect = 7e-06 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +1 Query: 175 LELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLD-PSAEHGVTKFS 342 LEL F F +F ++Y EEHAHRL +F NL +A+R Q D +AE GVT FS Sbjct: 36 LELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFS 92
>CATW_FELCA (Q9TST1) Cathepsin W precursor (EC 3.4.22.-)| Length = 374 Score = 43.1 bits (100), Expect = 2e-04 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +1 Query: 133 IRQVVGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLD- 309 I+ + DP LEL F F ++ ++Y + EE+A RL +F NL +A++ + D Sbjct: 22 IKSSLRSQDPGPQPLELKQAFTLFQIQYNRSYSNPEEYARRLDIFAHNLAQAQQLEEEDL 81 Query: 310 PSAEHGVTKFS 342 +AE GVT FS Sbjct: 82 GTAEFGVTPFS 92
>LMCPB_LEIME (P36400) Cysteine proteinase B precursor (EC 3.4.22.-)| Length = 443 Score = 42.0 bits (97), Expect = 4e-04 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKF 339 F F + +G+ Y E RL+ F+ NL R HQ +P A+ G+TKF Sbjct: 38 FEEFKRTYGRAYETLAEEQQRLANFERNLELMREHQARNPHAQFGITKF 86
>CYSP2_LEIPI (Q05094) Cysteine proteinase 2 precursor (EC 3.4.22.-) (Amastigote| cysteine proteinase A-2) Length = 444 Score = 42.0 bits (97), Expect = 4e-04 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKF 339 F F + +G+ Y E RL+ F+ NL R HQ +P A+ G+TKF Sbjct: 38 FEEFKRTYGRAYETLAEEQQRLANFERNLELMREHQARNPHAQFGITKF 86
>CATW_MOUSE (P56203) Cathepsin W precursor (EC 3.4.22.-) (Lymphopain)| Length = 371 Score = 39.3 bits (90), Expect = 0.002 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +1 Query: 175 LELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLD-PSAEHGVTKFS 342 LEL F F RF ++Y + E+ RLS+F NL +A+R Q D +AE G T FS Sbjct: 34 LELKEVFKLFQIRFNRSYWNPAEYTRRLSIFAHNLAQAQRLQQEDLGTAEFGETPFS 90
>CATV_NPVOP (O10364) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 38.5 bits (88), Expect = 0.004 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 142 VVGGADPLDYDL-ELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSA 318 V G YDL + + F F+ +F K Y E HR +F+ NL D +A Sbjct: 10 VCGVVHAATYDLLKAPNYFEDFLHKFNKNYSSESEKLHRFKIFQHNLEEIINKNQNDSTA 69 Query: 319 EHGVTKFS 342 ++ + KFS Sbjct: 70 QYEINKFS 77
>CATV_NPVHZ (Q8V5U0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 367 Score = 37.4 bits (85), Expect = 0.009 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANLRR------------ARRHQLLDPSAEHGVTK 336 F F+Q++ K+Y D +E+ +R +VFK NL + + L SA+ GV K Sbjct: 57 FKHFLQQYNKSYDDPKEYQYRYNVFKDNLNKINSQNRENLLNNKNNNDSLSTSAQFGVNK 116 Query: 337 FS 342 FS Sbjct: 117 FS 118
>CATV_NPVAP (Q91CL9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 36.6 bits (83), Expect = 0.016 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +1 Query: 169 YDL-ELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 YDL + S F F+ +F K Y E R +F+ NL D SA++ + KFS Sbjct: 19 YDLLKAPSYFEEFLHKFNKNYSSESEKLRRFKIFQHNLEEIINKNQNDTSAQYEINKFS 77
>CYSP_PLAVS (P42666) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 583 Score = 35.4 bits (80), Expect = 0.035 Identities = 19/75 (25%), Positives = 38/75 (50%) Frame = +1 Query: 118 DEEPLIRQVVGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRH 297 +EE + Q+ G L +L+ S+F F+ ++ ++Y+D E + FK N + ++H Sbjct: 216 EEEVSVAQIEG----LFVNLKYASKFFNFMNKYKRSYKDINEQMEKYKNFKMNYLKIKKH 271 Query: 298 QLLDPSAEHGVTKFS 342 + + V +FS Sbjct: 272 NETNQMYKMKVNQFS 286
>ALEU_ARATH (Q8H166) Thiol protease aleurain precursor (EC 3.4.22.16) (AtALEU)| (Senescence-associated gene product 2) Length = 358 Score = 35.4 bits (80), Expect = 0.035 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 F F R+GK Y++ EE R S+FK NL R S + GV +F+ Sbjct: 59 FARFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFA 108
>CATV_NPVCF (P41715) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 35.0 bits (79), Expect = 0.046 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 142 VVGGADPLDYD-LELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSA 318 V G YD L+ + F F+ +F K+Y E R +F+ NL D +A Sbjct: 10 VYGAVQCAAYDVLKAPNYFEDFLHKFNKSYSSESEKLRRFQIFRHNLEEIINKNHNDSTA 69 Query: 319 EHGVTKFS 342 ++ + KF+ Sbjct: 70 QYEINKFA 77
>CATV_NPVCD (O41479) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 324 Score = 35.0 bits (79), Expect = 0.046 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 142 VVGGADPLDYD-LELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSA 318 V G YD L+ + F F+ +F K+Y E R +F+ NL D +A Sbjct: 10 VYGAVQCAAYDVLKAPNYFEDFLHKFNKSYSSESEKLRRFQIFRHNLEEIINKNHNDSTA 69 Query: 319 EHGVTKFS 342 ++ + KF+ Sbjct: 70 QYEINKFA 77
>CRUST_PANBO (Q86GF7) Crustapain precursor (EC 3.4.22.-) (NsCys)| Length = 323 Score = 34.7 bits (78), Expect = 0.060 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 190 QFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRH 297 ++ F +FGK Y ++EE +HR+SVF L+ + H Sbjct: 19 EWENFKTKFGKKYANSEEESHRMSVFMDKLKFIQEH 54
>CATV_GVCP (O91466) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 333 Score = 34.3 bits (77), Expect = 0.079 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 154 ADPLDYDLE-LDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGV 330 A L YDL D F F ++ KTY EE A +L FK NL+ + A + Sbjct: 18 AHALTYDLNNSDELFKNFAIKYNKTYVSDEERAIKLENFKNNLKMINEKNMASKYAVFDI 77 Query: 331 TKFS 342 ++S Sbjct: 78 NEYS 81
>CATV_NPVAH (Q80LP4) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 337 Score = 34.3 bits (77), Expect = 0.079 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 163 LDYDLELDSQ--FVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTK 336 L +D+ D+Q F F+ + K Y D + +R +FK NL L+ SA + + K Sbjct: 21 LKFDIH-DAQHYFETFIINYNKQYPDTKTKNYRFKIFKQNLEDINEKNKLNDSAIYNINK 79 Query: 337 FS 342 FS Sbjct: 80 FS 81
>CPR1_DROME (Q9VN93) Putative cysteine proteinase CG12163 precursor (EC| 3.4.22.-) Length = 614 Score = 33.5 bits (75), Expect = 0.13 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +1 Query: 178 ELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLD-PSAEHGVTKFS 342 ++D F F RFG+ Y E RL +F+ NL+ + SA++G+T+F+ Sbjct: 303 KVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKYGITEFA 358
>CATV_NPVBS (Q9YWK4) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 331 Score = 33.5 bits (75), Expect = 0.13 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +1 Query: 169 YDL-ELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 YDL + F F+ + K Y D E R S+F+ L L+ SA + + KF+ Sbjct: 22 YDLLKAGDYFETFLANYNKMYNDTSEKERRFSIFQQTLEEINYKNRLNDSAVYQINKFA 80
>CYSP1_DICDI (P04988) Cysteine proteinase 1 precursor (EC 3.4.22.-)| Length = 343 Score = 32.7 bits (73), Expect = 0.23 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = +1 Query: 178 ELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLL----DPSAEHGVTKFS 342 E SQF+ F +F K Y EE+ R +FK+NL + L+ + GV KF+ Sbjct: 24 EEQSQFLEFQDKFNKKYSH-EEYLERFEIFKSNLGKIEELNLIAINHKADTKFGVNKFA 81
>CPR2_ARATH (Q9LXW3) Probable cysteine proteinase At3g43960 precursor (EC| 3.4.22.-) Length = 376 Score = 32.7 bits (73), Expect = 0.23 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 217 GKTYRDAEEHAHRLSVFKANLRRARRHQLLDP--SAEHGVTKFS 342 GK Y E R +FK NL+R H DP S E G+ KFS Sbjct: 49 GKNYNGLGEKERRFKIFKDNLKRIEEHN-SDPNRSYERGLNKFS 91
>CYSP_PLAFA (P25805) Trophozoite cysteine proteinase precursor (EC 3.4.22.-)| (TCP) Length = 569 Score = 32.3 bits (72), Expect = 0.30 Identities = 14/54 (25%), Positives = 30/54 (55%) Frame = +1 Query: 157 DPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSA 318 DP++ +++ S+F F++ K Y++ +E + +FK N + H L+ +A Sbjct: 214 DPIN-NIKYASKFFKFMKEHNKVYKNIDEQMRKFEIFKINYISIKNHNKLNKNA 266
>ALEUL_ARATH (Q8RWQ9) Thiol protease aleurain-like precursor (EC 3.4.22.16)| Length = 358 Score = 32.0 bits (71), Expect = 0.39 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANL 279 F F R+GK Y+ EE R SVFK NL Sbjct: 59 FSRFTHRYGKKYQSVEEMKLRFSVFKENL 87
>CATV_GVXN (Q9PYY5) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 346 Score = 31.6 bits (70), Expect = 0.51 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSA 318 F FV ++ K Y+D +E R +FK NL L+ SA Sbjct: 43 FNEFVVKYNKVYKDDQEKEARFEIFKQNLADINARNALEDSA 84
>CPR4_ARATH (Q9SUS9) Probable cysteine proteinase At4g11320 precursor (EC| 3.4.22.-) Length = 371 Score = 31.2 bits (69), Expect = 0.67 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +1 Query: 169 YDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 +D E F ++ + GK Y E RL++F+ NLR + S G+ +F+ Sbjct: 48 FDAEATLMFESWMVKHGKVYDSVAEKERRLTIFEDNLRFITNRNAENLSYRLGLNRFA 105
>CPR3_ARATH (Q9SUT0) Probable cysteine proteinase At4g11310 precursor (EC| 3.4.22.-) Length = 364 Score = 31.2 bits (69), Expect = 0.67 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +1 Query: 169 YDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 +D E F ++ + GK Y E RL++F+ NLR + S G+T F+ Sbjct: 41 FDAEASLIFESWMVKHGKVYGSVAEKERRLTIFEDNLRFINNRNAENLSYRLGLTGFA 98
>CYSP_THEAN (P25781) Cysteine proteinase precursor (EC 3.4.22.-)| Length = 441 Score = 30.8 bits (68), Expect = 0.87 Identities = 14/60 (23%), Positives = 29/60 (48%) Frame = +1 Query: 133 IRQVVGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDP 312 IRQ + +L++ +F FV+++ K +R ++ R F+ N + H+ +P Sbjct: 100 IRQTGKITSDAESELDMLIEFDAFVEKYKKVHRSFDQRVQRFLTFRKNYHIVKTHKPTEP 159
>CATV_NPVLD (Q9YMP9) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 356 Score = 30.8 bits (68), Expect = 0.87 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANLR--RARRHQLLD-PSAEHGVTKFS 342 F FV+ + K Y E R S+FK NL A+ D P+A + + KFS Sbjct: 56 FESFVENYNKNYTSDWEKNKRYSIFKDNLHEINAKNGNATDGPTATYKINKFS 108
>ALEU_HORVU (P05167) Thiol protease aleurain precursor (EC 3.4.22.16)| Length = 362 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = +1 Query: 190 QFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 +F F R+GK+Y A E R +F +L R G+ +FS Sbjct: 60 RFARFAVRYGKSYESAAEVRRRFRIFSESLEEVRSTNRKGLPYRLGINRFS 110
>TATB_VIBPA (Q87TH0) Sec-independent protein translocase protein tatB homolog| Length = 132 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +1 Query: 142 VVGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAE 321 VV G + L + + S+F+G + + +D H ++ + NLR+A + + D S E Sbjct: 18 VVLGPERLPHAIRSVSRFIGAAKNMANSVKDELSHELKVQELQENLRKAEQMGMEDLSPE 77
>CYSP2_MAIZE (Q10717) Cysteine proteinase 2 precursor (EC 3.4.22.-)| Length = 360 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 190 QFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 +F F R+GK+Y A E R +F +L+ R S G+ +F+ Sbjct: 58 RFARFAVRYGKSYESAAEVHKRFRIFSESLQLVRSTNRKGLSYRLGINRFA 108
>CYSP3_LYCES (Q40143) Cysteine proteinase 3 precursor (EC 3.4.22.-)| Length = 356 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 F F R K Y EE R +F NL+ R H S + G+ +F+ Sbjct: 57 FARFAIRHRKRYDSVEEIKQRFEIFLDNLKMIRSHNRKGLSYKLGINEFT 106
>CATH_HUMAN (P09668) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 28.9 bits (63), Expect = 3.3 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = +1 Query: 145 VGGADPLDYDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQLLDPSAEH 324 V GA L + F ++ + KTY EE+ HRL F +N R+ H + + + Sbjct: 19 VCGAAELSVNSLEKFHFKSWMSKHRKTY-STEEYHHRLQTFASNWRKINAHNNGNHTFKM 77 Query: 325 GVTKFS 342 + +FS Sbjct: 78 ALNQFS 83
>XCP1_ARATH (O65493) Xylem cysteine proteinase 1 precursor (EC 3.4.22.-)| (AtXCP1) Length = 355 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 193 FVGFVQRFGKTYRDAEEHAHRLSVFKANL 279 F ++ K Y+ EE HR VF+ NL Sbjct: 51 FESWMSEHSKAYKSVEEKVHRFEVFRENL 79
>CATH_PIG (O46427) Cathepsin H precursor (EC 3.4.22.16) [Contains: Cathepsin| H mini chain; Cathepsin H heavy chain; Cathepsin H light chain] Length = 335 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 238 EEHAHRLSVFKANLRRARRHQLLDPSAEHGVTKFS 342 EE+ HRL VF +N R+ H + + + G+ +FS Sbjct: 49 EEYHHRLQVFVSNWRKINAHNAGNHTFKLGLNQFS 83
>BROM1_ANACO (O23791) Bromelain precursor (EC 3.4.22.32) (Allergen Ana c 2)| Length = 351 Score = 27.3 bits (59), Expect = 9.6 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +1 Query: 190 QFVGFVQRFGKTYRDAEEHAHRLSVFKANLR 282 +F ++ +G+ Y+D +E R +FK N++ Sbjct: 36 RFEEWMAEYGRVYKDDDEKMRRFQIFKNNVK 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,133,846 Number of Sequences: 219361 Number of extensions: 379269 Number of successful extensions: 1311 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 1297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1309 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
