| Clone Name | baet65a01 |
|---|---|
| Clone Library Name | barley_pub |
>AT7L1_HUMAN (Q9ULK2) Ataxin-7-like protein 1 (Fragment)| Length = 864 Score = 33.5 bits (75), Expect = 0.23 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = +1 Query: 7 ASLRLAWRKREGRARHRHTHT-----LTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQR 171 +SL L++ K EG+ R + + +T P ++PPSL++ P P N S +Q Sbjct: 769 SSLPLSFDKSEGKKRKNSSSSSKACKITKMPGMNSVHKKNPPSLLAPVPDPVNSTSSRQV 828 Query: 172 TESPSSLLCRPHPLS 216 ++ S L + P S Sbjct: 829 GKNSSLALSQSSPSS 843
>YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'region of gyrA and| gyrB (ORF 3) Length = 437 Score = 33.1 bits (74), Expect = 0.30 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +1 Query: 25 WRKREGRARHRHTHTLTLAP-DRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCR 201 WR+R R RHR P DR+R R+ P + A P++ + + R S Sbjct: 339 WRRRRRRVRHREGALPAAHPDDRRRRRRRAHPDAAAYASVPAHAPAHRGRLRVRGSTAAV 398 Query: 202 PHPL 213 P PL Sbjct: 399 PRPL 402
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 32.3 bits (72), Expect = 0.51 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 82 PDRKRSAPRSPPSL-VSTAPPPSNLGSPKQRTESPS 186 P ++R++P PP VS +PPP SP + SPS Sbjct: 620 PPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPS 655 Score = 30.0 bits (66), Expect = 2.5 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = +1 Query: 4 RASLRLAWRKREGRARHRHTHTLTLAPDRKRSAPRSPPSL--VSTAPPPSNLG--SPKQR 171 R S L+ + R+G + R T KR +P P S++PPP G S QR Sbjct: 651 RRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQR 710 Query: 172 TESPS 186 +SPS Sbjct: 711 RQSPS 715 Score = 29.3 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +1 Query: 82 PDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSARAT 228 P R+R P PP + +PPP +R P P P R T Sbjct: 566 PPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRT 614 Score = 28.5 bits (62), Expect = 7.4 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = +1 Query: 28 RKREGRARHRHTHTLTLAPDRKRSAP--RSPPSLVSTAPPPSNLGSPKQRTESPSSLLCR 201 R++E R R + + P R+R +P PP T PP P++RT SP Sbjct: 536 RQKETSPRGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPP-----PRRRTPSPPPRRRS 590 Query: 202 PHP 210 P P Sbjct: 591 PSP 593
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 32.3 bits (72), Expect = 0.51 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 82 PDRKRSAPRSPPSL-VSTAPPPSNLGSPKQRTESPS 186 P ++R++P PP VS +PPP SP + SPS Sbjct: 634 PPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPS 669 Score = 29.6 bits (65), Expect = 3.3 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +1 Query: 4 RASLRLAWRKREGRARHRHTHTLTLAPDRKRSAPRSPPSLVST-APPPSNLG--SPKQRT 174 R S L+ + R+G + R T KR +P P T +PPP G S QR Sbjct: 665 RRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSPPPVRRGASSSPQRR 724 Query: 175 ESPS 186 +SPS Sbjct: 725 QSPS 728 Score = 29.3 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +1 Query: 82 PDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSARAT 228 P R+R P PP + +PPP +R P P P R T Sbjct: 580 PPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRT 628
>CXA5_CHICK (P18860) Gap junction alpha-5 protein (Connexin-42) (Cx42)| Length = 368 Score = 32.3 bits (72), Expect = 0.51 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +1 Query: 19 LAWRKREGRARHRHTHTLTLAPDRKRSAPRSPPSLVSTAPPPSN--LGSPKQRTESPSS 189 L W+K + R + + + AP R SAP+ + + T PP N L SP + SP S Sbjct: 233 LGWKKAKERCSRAYKPSPSTAPRRLESAPQVERAQMYTPPPDFNQCLASPNGKFISPFS 291
>CNGB1_HUMAN (Q14028) Cyclic nucleotide-gated cation channel 4 (CNG channel 4)| (CNG-4) (CNG4) (Cyclic nucleotide-gated cation channel modulatory subunit) Length = 909 Score = 32.0 bits (71), Expect = 0.67 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 46 ARHRHTHTLTLAPDRKRS-APRSPPSLVSTAPPPSNLGSPKQRTESPS 186 A +HTH A D P PP ++PPP++LGS + E P+ Sbjct: 827 APDQHTHPKEAATDPPAPRTPPEPPGSPPSSPPPASLGSCEGEEEGPA 874
>PHYB_SORBI (P93527) Phytochrome B| Length = 1178 Score = 32.0 bits (71), Expect = 0.67 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = +1 Query: 97 SAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSAR 222 S S PSL S APPP +LG+ + SPSS + +AR Sbjct: 156 SPHHSVPSLDSAAPPPVSLGADARLLFSPSSAVLLERAFAAR 197
>RSP4_CAEEL (Q09511) Probable splicing factor, arginine/serine-rich 4| (RNA-binding protein srp-2) (CeSC35) Length = 196 Score = 32.0 bits (71), Expect = 0.67 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 15/63 (23%) Frame = +1 Query: 28 RKREGRARHRHT-HTLTLAPDRKRSAPRSPPSLV--------------STAPPPSNLGSP 162 R R R R R ++ + +P R RS RSPPS S +PPP GSP Sbjct: 115 RSRSPRRRSRSPRYSRSRSPRRSRSRTRSPPSRDRRDSPDRRDNSRSRSRSPPPREDGSP 174 Query: 163 KQR 171 K+R Sbjct: 175 KER 177
>ABIL3_ORYSA (Q5NB83) Probable protein ABIL3 (Abl interactor-like protein 3)| Length = 317 Score = 30.8 bits (68), Expect = 1.5 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +1 Query: 4 RASLRLAWRKREGRARHRHTHTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSP 162 R S + R AR H + +L+P RK A P ++ST + GSP Sbjct: 191 RQSTMRSARSPSPSARGTHHRSRSLSPSRKARAKSPSPQIISTQTKETRAGSP 243
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 30.8 bits (68), Expect = 1.5 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +1 Query: 73 TLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHP 210 T P + SPP++ +T PPP+ SP T + P P Sbjct: 1575 TTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP 1620 Score = 29.6 bits (65), Expect = 3.3 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 Query: 61 THTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHP 210 T T TL P + P PP+ +T PP + P T SP ++ P Sbjct: 1551 TSTTTLPPT---TTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPP 1597 Score = 28.9 bits (63), Expect = 5.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 109 SPPSLVSTAPPPSNLGSPKQRTESPSSLLCRP 204 SPP +T PPP+ SP T SP + P Sbjct: 1455 SPPISTTTTPPPTTTPSPPTTTPSPPTTTPSP 1486 Score = 28.5 bits (62), Expect = 7.4 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +1 Query: 61 THTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESP 183 T T TL P + P PP+ +T PP + P T SP Sbjct: 1630 TSTTTLPPT---TTPSPPPTTTTTPPPTTTPSPPTTTTPSP 1667 Score = 28.5 bits (62), Expect = 7.4 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = +1 Query: 61 THTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHP 210 T T TL P + SPP+ +T PPP+ SP T + P P Sbjct: 1411 TTTTTLPP----TTTPSPPTTTTTTPPPTTTPSPPITTTTTPLPTTTPSP 1456
>WSP1_SCHPO (O36027) Wiskott-Aldrich syndrome homolog protein 1| Length = 574 Score = 30.4 bits (67), Expect = 1.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 103 PRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHP 210 P +PPSL +APP +G+P PS+ + P P Sbjct: 425 PSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLP 460
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 30.4 bits (67), Expect = 1.9 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = +1 Query: 4 RASLRLAWRKREGRARHRHTHTLTLAPDRKRSAPRSPP--SLVSTAPPPSNLG--SPKQR 171 R S ++ + R+G R P KR +P P S S++PPP G + QR Sbjct: 644 RRSPSISSKHRKGSPPSRSNRETRSPPQNKRDSPSPRPRASHTSSSPPPLRRGASASPQR 703 Query: 172 TESPS 186 +SPS Sbjct: 704 RQSPS 708 Score = 29.6 bits (65), Expect = 3.3 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 67 TLTLAPDRKRSAPRSPPSL--VSTAPPPSNLGSPKQRTESPS 186 T + P KR A SP S VS +PPP SP + SPS Sbjct: 607 TASPPPPPKRRASPSPQSKRRVSHSPPPKQRSSPAAKRRSPS 648
>MUC1_HYLLA (Q29435) Mucin-1 precursor (MUC-1)| Length = 475 Score = 30.4 bits (67), Expect = 1.9 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 13/68 (19%) Frame = +1 Query: 64 HTLTLAPDRK-------------RSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRP 204 H +T APD + SAP + P+L STAPP N+ S +S L Sbjct: 136 HGVTSAPDTRPTLGSTAPPVHGVTSAPDTRPTLGSTAPPVHNVTSASGSASGSASTLVH- 194 Query: 205 HPLSARAT 228 + SARAT Sbjct: 195 NGTSARAT 202
>MUC1_HUMAN (P15941) Mucin-1 precursor (MUC-1) (Polymorphic epithelial mucin)| (PEM) (PEMT) (Episialin) (Tumor-associated mucin) (Carcinoma-associated mucin) (Tumor-associated epithelial membrane antigen) (EMA) (H23AG) (Peanut-reactive urinary mucin) (PUM) Length = 1255 Score = 30.4 bits (67), Expect = 1.9 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 13/68 (19%) Frame = +1 Query: 64 HTLTLAPDRK-------------RSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRP 204 H +T APD + SAP + P+L STAPP N+ S +S L Sbjct: 916 HGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVH- 974 Query: 205 HPLSARAT 228 + SARAT Sbjct: 975 NGTSARAT 982
>CCD95_RAT (Q6AYH2) Coiled-coil domain-containing protein 95| Length = 244 Score = 30.0 bits (66), Expect = 2.5 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +1 Query: 73 TLAPDRKRSAPR-SPPSLVSTAPPPSNLGSPKQRTESP----SSLLCRPHP 210 T AP RKRS P PS S + PPS+ G P Q + +P SSL P+P Sbjct: 90 TPAPKRKRSPPMGGAPSPSSLSLPPSS-GFPLQTSGAPSPYLSSLASPPYP 139
>EGR2_MOUSE (P08152) Early growth response protein 2 (EGR-2) (Krox-20 protein)| Length = 470 Score = 30.0 bits (66), Expect = 2.5 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 49 RHRHTHTLTLAPDRKRSAPRSPPSLVSTAPPP 144 R RHT +RK SAP +PPS S+A P Sbjct: 410 RKRHTKIHLRQKERKSSAPSAPPSAQSSASGP 441
>PHC3_HUMAN (Q8NDX5) Polyhomeotic-like protein 3 (hPH3) (Homolog of| polyhomeotic 3) (Early development regulatory protein 3) Length = 983 Score = 30.0 bits (66), Expect = 2.5 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +1 Query: 58 HTHTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSARA 225 H LT++P++ +SA +S V +PPP + S L +PHPL + A Sbjct: 378 HPSPLTVSPNQSQSAQQS----VVVSPPPPHSPSQSPTIIIHPQALIQPHPLVSSA 429
>NUCKS_HUMAN (Q9H1E3) Nuclear ubiquitous casein and cyclin-dependent kinases| substrate (P1) Length = 243 Score = 30.0 bits (66), Expect = 2.5 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 73 TLAPDRKRSAPRSPPSL-VSTAPPPSNLGSPKQRTESPS 186 T +P + P SPP ST+PPP G E+PS Sbjct: 202 TPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPS 240
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 29.6 bits (65), Expect = 3.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = +1 Query: 82 PDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSARAT 228 P R+R +P PP + +PPP +R P P P R T Sbjct: 585 PPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRT 633
>GAB2_HUMAN (Q9UQC2) GRB2-associated binding protein 2 (GRB2-associated binder| 2) (pp100) Length = 676 Score = 29.6 bits (65), Expect = 3.3 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 76 LAPDRKRSAPR--SPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSARA 225 L +RK SAP S P+L + PP SN P T +P L +S RA Sbjct: 152 LLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRA 203
>HXA3_HUMAN (O43365) Homeobox protein Hox-A3 (Hox-1E)| Length = 443 Score = 29.6 bits (65), Expect = 3.3 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 79 APDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPL 213 AP + AP+ P + PPPS+ P+ + +P+ PL Sbjct: 101 APQPPQPAPQPPAPTPAAPPPPSSASPPQNASNNPTPANAAKSPL 145
>RT22_MOUSE (Q9CXW2) Mitochondrial 28S ribosomal protein S22 (S22mt) (MRP-S22)| Length = 359 Score = 29.6 bits (65), Expect = 3.3 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 4/64 (6%) Frame = +1 Query: 25 WRKREGRARHRHTHTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQ----RTESPSSL 192 WR + G R R T + +A R P +L++T P P +G P++ ES SS Sbjct: 11 WRFQLGSRRARRVCT-------RATAQRHPDALLATRPQPFEVGQPRRLLSSEAESGSSE 63 Query: 193 LCRP 204 + +P Sbjct: 64 VKKP 67
>CUTL1_HUMAN (P39880) Homeobox protein cut-like 1 (CCAAT displacement protein)| (CDP) Length = 1505 Score = 29.3 bits (64), Expect = 4.3 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 97 SAPRSPPSLVSTAPPPSNLGSPK--QRTESPSSLLCRPHPLSAR 222 +AP P+ S+APPPSN S +R S SL P AR Sbjct: 1426 AAPGEGPAAPSSAPPPSNSSSSSAPRRPSSLQSLFGLPEAAGAR 1469
>SLM9_SCHPO (O74309) Mitotic control protein slm9| Length = 807 Score = 29.3 bits (64), Expect = 4.3 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +1 Query: 103 PRSPPSLVSTAPPPSNLGSPK-QRTESPSSLLCR---PHPLS 216 P SP + PPPS SP+ +R + P + R PHP S Sbjct: 404 PESPSKSILLRPPPSIASSPESKRRKCPKKFVARPPVPHPTS 445
>PHC3_MOUSE (Q8CHP6) Polyhomeotic-like protein 3| Length = 981 Score = 29.3 bits (64), Expect = 4.3 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +1 Query: 58 HTHTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSARA 225 H LT++P++ +SA +S V +PPP + S L +PHPL + A Sbjct: 375 HPPPLTVSPNQAQSAQQS----VVVSPPPPHSPSQSPTIIIHPQALIQPHPLVSSA 426
>EXTN2_ARATH (Q9M1G9) Extensin-2 precursor (AtExt2) (Cell wall| hydroxyproline-rich glycoprotein 1) (HRGP1) Length = 743 Score = 29.3 bits (64), Expect = 4.3 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 67 TLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESP 183 T T AP+ + +P PP + S+ PPP+ SPK +SP Sbjct: 59 TYTPAPEVEYKSP-PPPYVYSSPPPPTYSPSPKVDYKSP 96
>MUCDL_RAT (Q9JIK1) Mucin and cadherin-like protein precursor| (Mu-protocadherin) (GP100) Length = 862 Score = 29.3 bits (64), Expect = 4.3 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 76 LAPDRKRSAPRSPPSLVSTAPPPSNLGSPK--QRTESPSSL 192 L P S+ +PPS + +P P GSPK Q +SPS++ Sbjct: 747 LRPPSPMSSSPTPPSSMPPSPQPKASGSPKTVQAGDSPSAV 787
>FOXL2_HUMAN (P58012) Forkhead box protein L2| Length = 376 Score = 29.3 bits (64), Expect = 4.3 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 52 HRHTHTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSA 219 H H H L A + P +PP + APPP L T +P + P P SA Sbjct: 293 HPHAHHLHAAA----APPPAPPHHGAAAPPPGQLSPASPATAAPPA----PAPTSA 340
>MMPL3_MYCTU (O53657) Putative membrane protein mmpL3| Length = 944 Score = 29.3 bits (64), Expect = 4.3 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = +1 Query: 7 ASLRLAWRKREGRARHRHTHTLTLAPDRKRSAPRSPPSLV----STAPPPSNLGSPKQRT 174 A L A + R H TH L +P RS+P S P L +TA P + G+ R Sbjct: 771 AGLVAARAAGDPRPPHDPTHPLAESPRPARSSPASSPELTPALEATAAPAAPSGASTTRM 830 Query: 175 ESPSS 189 + SS Sbjct: 831 QIGSS 835
>MAP1A_MOUSE (Q9QYR6) Microtubule-associated protein 1A (MAP 1A) (Fragment)| Length = 1021 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 97 SAPRSPPSLVSTAPPPSNLGSPKQRTESPSSL 192 S PR+PP+ APPP+ G + SP L Sbjct: 724 SEPRTPPAQKGAAPPPAASGHRELALSSPEDL 755
>FOXL2_MOUSE (O88470) Forkhead box protein L2 (Pituitary forkhead factor)| (P-Frk) Length = 375 Score = 29.3 bits (64), Expect = 4.3 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 52 HRHTHTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSA 219 H H H L A + P +PP + APPP L T +P + P P SA Sbjct: 292 HPHAHHLHAAA----APPPAPPHHGAAAPPPGQLSPASPATAAPPA----PAPTSA 339
>CCD95_BOVIN (Q29RS4) Coiled-coil domain-containing protein 95| Length = 244 Score = 28.9 bits (63), Expect = 5.7 Identities = 20/42 (47%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 73 TLAPDRKRSAP-RSPPSLVSTAPPPSNLGSPKQRTESPSSLL 195 T AP RKRS P PS S + PPS G P Q + +PS L Sbjct: 90 TPAPKRKRSPPLGGAPSPSSLSLPPST-GFPLQASRAPSPYL 130
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.9 bits (63), Expect = 5.7 Identities = 31/118 (26%), Positives = 39/118 (33%), Gaps = 10/118 (8%) Frame = +1 Query: 43 RARHRHTHTLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQR------TESPSSLLCRP 204 R R R + +P R RS RSP A PP G R + SPS R Sbjct: 804 RGRGRSYDRYSRSPSRSRSRTRSP-----AAAPPIRRGRSGTRSRSRSYSRSPSPPPARG 858 Query: 205 HPLSARATMXXXXXXXXXXXXXXXXXXXXXXXXRH----GRLRKGFPYTSRSKAGFQI 366 +P RA + H RLR+G SRS++ I Sbjct: 859 YPTRGRAPVSNNDRAAAASGKRRREGSYSASRSPHPPPQQRLRRGSYSRSRSRSPIPI 916
>INO80_CRYNE (Q5KHM0) Putative DNA helicase INO80 (EC 3.6.1.-)| Length = 1765 Score = 28.9 bits (63), Expect = 5.7 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 67 TLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRP 204 T L DR R PP PPPS +G R SPS+ + P Sbjct: 160 TERLPIDRYRRDIDVPPLPRQLPPPPSEIGRMADRARSPSAPIAPP 205
>TF65_CHICK (P98152) Transcription factor p65 (Nuclear factor NF-kappa-B p65| subunit) Length = 558 Score = 28.9 bits (63), Expect = 5.7 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 82 PDRKRSAPRSPPSLVSTAPPP-SNLGSPKQRTESPSSL 192 P R AP+ PPS+V P P LG P + +P L Sbjct: 341 PSRPPPAPQQPPSMVGAPPAPLFPLGVPPASSPTPEPL 378
>MUCDL_MOUSE (Q8VHF2) Mucin and cadherin-like protein precursor| (Mu-protocadherin) Length = 831 Score = 28.9 bits (63), Expect = 5.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 76 LAPDRKRSAPRSPPSLVSTAPPPSNLGSPK--QRTESPSSL 192 L P S+ +PPS +P P GSPK Q +SPS++ Sbjct: 717 LRPPSPMSSSPTPPSSTPPSPQPKASGSPKTVQAGDSPSAV 757
>IE18_PRVIF (P11675) Immediate-early protein IE180| Length = 1461 Score = 25.4 bits (54), Expect(2) = 6.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 76 LAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSS 189 L+P R SAPR+P + + A ++ S + S SS Sbjct: 366 LSPARSPSAPRAPAAAAAAARRSASSSSSSSSSSSSSS 403 Score = 21.6 bits (44), Expect(2) = 6.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 174 GIPFVAAVPPPSP 212 G P A PPPSP Sbjct: 416 GAPLARAGPPPSP 428
>IRS1_HCMVA (P09715) Protein IRS1 (HQRF1)| Length = 846 Score = 28.5 bits (62), Expect = 7.4 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 Query: 82 PDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRP 204 P +K P PP L T P P L PKQR S + P Sbjct: 739 PPQKHKPPDKPPRLCKTGPGPPPL-PPKQRHGSTDGKVSAP 778
>PANK4_RAT (Q923S8) Pantothenate kinase 4 (EC 2.7.1.33) (Pantothenic acid| kinase 4) (rPanK4) Length = 773 Score = 28.5 bits (62), Expect = 7.4 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 182 GDSVRCLGLPRLDGGGAVETRLGGERGADL 93 G S CL L RLD G AV R ERGADL Sbjct: 694 GSSPPCLDLSRLDKGLAVLVR---ERGADL 720
>ERF_HUMAN (P50548) ETS domain-containing transcription factor ERF (Ets2| repressor factor) Length = 548 Score = 28.5 bits (62), Expect = 7.4 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +1 Query: 82 PDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSAR 222 P R P PP T P PS+ S + SP +P PL R Sbjct: 342 PQRPDKCPL-PPMAPETPPVPSSASSSSSSSSSPFKFKLQPPPLGRR 387
>ERF_MOUSE (P70459) ETS domain-containing transcription factor ERF| Length = 551 Score = 28.5 bits (62), Expect = 7.4 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +1 Query: 82 PDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLSAR 222 P R P PP T P PS+ S + SP +P PL R Sbjct: 342 PQRPDKCPL-PPMAPETPPVPSSASSSSSSSSSPFKFKLQPPPLGRR 387
>CO4A5_CANFA (Q28247) Collagen alpha-5(IV) chain precursor| Length = 1691 Score = 28.5 bits (62), Expect = 7.4 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 97 SAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPLS 216 S PR P L PP +LG P Q+ E + L P L+ Sbjct: 490 SGPRGQPGLPGLPGPPGSLGFPGQKGEKGHAGLTGPKGLT 529
>WASL_BOVIN (Q95107) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 28.5 bits (62), Expect = 7.4 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 82 PDRKRSAPRSPPSLVST-APPPSNLGSPKQRTESPSSLLCRPHPLSA 219 P R R AP PPS T APPP P P P PL A Sbjct: 303 PARGRGAPPPPPSRAPTAAPPPPPPSRPGVGAPPPPPNRMYPPPLPA 349
>IE18_PRVKA (P33479) Immediate-early protein IE180| Length = 1446 Score = 25.0 bits (53), Expect(2) = 8.5 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 76 LAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSS 189 L+P R SAPR+P + + S+ S + S SS Sbjct: 358 LSPARSPSAPRAPAAAARRSASSSSSSSSSSSSSSSSS 395 Score = 21.6 bits (44), Expect(2) = 8.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 174 GIPFVAAVPPPSP 212 G P A PPPSP Sbjct: 408 GAPLARAGPPPSP 420
>VRP1_YEAST (P37370) Verprolin| Length = 817 Score = 28.1 bits (61), Expect = 9.7 Identities = 22/60 (36%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Frame = +1 Query: 64 HTLTLAPDRKRSAPRSP----PSLVSTAPPPSNL----GSPKQRTESPSSLLCRPHPLSA 219 H P SAP P P L TAPPP +L +PK+ T +P+ P PL A Sbjct: 302 HKSPSQPPLPSSAPPIPTSHAPPLPPTAPPPPSLPNVTSAPKKATSAPAP---PPPPLPA 358
>MUC2_RAT (Q62635) Mucin-2 precursor (Intestinal mucin 2) (Fragment)| Length = 1513 Score = 28.1 bits (61), Expect = 9.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +1 Query: 67 TLTLAPDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRP 204 T T +P ++P P+ +T+P PS S T SP++ P Sbjct: 1453 TSTTSPTTSTTSPTPSPTTSTTSPTPSPTTSTTSPTPSPTTSTTSP 1498
>CWC22_ASPFU (Q4WKB9) Pre-mRNA-splicing factor cwc22| Length = 881 Score = 28.1 bits (61), Expect = 9.7 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 13/74 (17%) Frame = +1 Query: 28 RKREGRARHRHTHTLTLAPDRKRS----APRSPP--------SLV-STAPPPSNLGSPKQ 168 R + RAR R + +L+P R+R+ +P+ PP SL S +PPP ++ Sbjct: 784 RAVDARARGRRYSSQSLSPPRRRAERSVSPQRPPPGRRPRGDSLSRSPSPPPRYAREQRR 843 Query: 169 RTESPSSLLCRPHP 210 R S S+ R P Sbjct: 844 RRNSSSASASRSPP 857
>SSH_XENLA (Q6IVY4) Protein phosphatase Slingshot homolog (EC 3.1.3.48) (EC| 3.1.3.16) (xSSH) (Slingshot-related protein) Length = 691 Score = 28.1 bits (61), Expect = 9.7 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +1 Query: 40 GRARHRHTHTLTLAPDRKRSA----PRSPPSLVSTAPPPSNLGSPKQRTESP 183 G R T+ L ++R + P S PSL +PPP N SP T SP Sbjct: 422 GFMRQLQTYQGILGASKQRHSYLWDPSSAPSLPLMSPPPKNFSSP---TTSP 470
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 28.1 bits (61), Expect = 9.7 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 15/76 (19%) Frame = +1 Query: 43 RARHRHTHTLTLAPDRK----RSAPRS--PP---------SLVSTAPPPSNLGSPKQRTE 177 R+R + T +PDR +APRS PP S +S +P S SP++R + Sbjct: 778 RSRSPRGRSYTRSPDRAGPQASTAPRSGGPPRKAGSVDNRSPLSRSPSGSRSPSPRRRRD 837 Query: 178 SPSSLLCRPHPLSARA 225 SPS R RA Sbjct: 838 SPSRSPVRDRESGGRA 853
>HXA3_MOUSE (P02831) Homeobox protein Hox-A3 (Hox-1.5) (MO-10)| Length = 443 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = +1 Query: 79 APDRKRSAPRSPPSLVSTAPPPSNLGSPKQRTESPSSLLCRPHPL 213 AP + P+ P + PPPS++ P+ +P+ PL Sbjct: 102 APQPPQPPPQPPAPTPAAPPPPSSVSPPQSANSNPTPASTAKSPL 146
>RBF1_CAEEL (P41885) Rabphilin-1| Length = 1106 Score = 28.1 bits (61), Expect = 9.7 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 10 SLRLAWRKREGRARHRHTHTLTLAPDRKRSAPRSPPSLVSTAP 138 S R A +R R H H + L D S+P S PS ST+P Sbjct: 514 SRREANMERFSRHTHAHANRLYSTDDDDDSSPESRPSTRSTSP 556 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.128 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,976,191 Number of Sequences: 219361 Number of extensions: 731966 Number of successful extensions: 4336 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 3422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4223 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)