| Clone Name | baet64h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YOL7_CAEEL (Q02334) Hypothetical protein ZK370.7 in chromosome III | 28 | 4.1 | 2 | HM13_CAEEL (P17488) Homeobox protein ceh-13 | 28 | 5.3 | 3 | PCP2_RALSO (Q8XT56) Pyrrolidone-carboxylate peptidase 2 (EC 3.4.... | 28 | 5.3 | 4 | CATA_SALTY (P17750) Peroxidase/catalase HPI (EC 1.11.1.6) (Catal... | 27 | 9.1 | 5 | CATA_SALTI (Q8Z303) Peroxidase/catalase HPI (EC 1.11.1.6) (Catal... | 27 | 9.1 |
|---|
>YOL7_CAEEL (Q02334) Hypothetical protein ZK370.7 in chromosome III| Length = 355 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 3/62 (4%) Frame = +3 Query: 24 DRDTQASGTSPTPPRSSLVFQDPLALAHLTYSWLHFT---KKNQPRLRPGLIHRSVARSL 194 D+D + + SP+ R S VF+ +A +T+ W +T K + + P +++ S + L Sbjct: 22 DKDVEKADESPSSSRPSFVFK-CYVIASMTFIWTAYTLTIKYTRSTVNPDMMYSSTSVVL 80 Query: 195 LA 200 A Sbjct: 81 CA 82
>HM13_CAEEL (P17488) Homeobox protein ceh-13| Length = 202 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +3 Query: 9 GGRHRDRDTQASGTSPTPPRSSLVFQD----PLALAHLTYSWLHFTKKNQP 149 G H ASG SP RSS + A H TY W+H + +P Sbjct: 53 GNGHVSPPATASGLSPPASRSSNSSAELPTGVTASQHNTYKWMHTKRSQRP 103
>PCP2_RALSO (Q8XT56) Pyrrolidone-carboxylate peptidase 2 (EC 3.4.19.3)| (5-oxoprolyl-peptidase 2) (Pyroglutamyl-peptidase I 2) (PGP-I 2) (Pyrase 2) Length = 215 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 105 HLTYSWLHFTKKNQPRLRPGLIHRSVARSLLAR 203 HL Y +H PR+R G IH L AR Sbjct: 145 HLFYGLMHHIATRAPRMRGGFIHVPATPELAAR 177
>CATA_SALTY (P17750) Peroxidase/catalase HPI (EC 1.11.1.6)| (Catalase-peroxidase) (Hydroperoxidase I) Length = 726 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 18 HRDRDTQASGTSPTPPRSSLVFQDPL 95 HRD +A P P+ L++QDPL Sbjct: 413 HRDMGPKARYIGPEVPKEDLIWQDPL 438
>CATA_SALTI (Q8Z303) Peroxidase/catalase HPI (EC 1.11.1.6)| (Catalase-peroxidase) (Hydroperoxidase I) Length = 726 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 18 HRDRDTQASGTSPTPPRSSLVFQDPL 95 HRD +A P P+ L++QDPL Sbjct: 413 HRDMGPKARYIGPEVPKEDLIWQDPL 438 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,428,001 Number of Sequences: 219361 Number of extensions: 702567 Number of successful extensions: 2056 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2056 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)