| Clone Name | baet64d10 |
|---|---|
| Clone Library Name | barley_pub |
>EA92_VICFA (P21747) Embryonic abundant protein USP92 precursor| Length = 268 Score = 37.7 bits (86), Expect = 0.012 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 244 +L+ +A VG A + YW+S PNTP+P + S LL Sbjct: 8 VLSLFCLAFVGITATSSEEDYWQSIWPNTPLPKTFSDLL 46
>EA30_VICFA (P21745) Embryonic abundant protein VF30.1 precursor| Length = 268 Score = 37.4 bits (85), Expect = 0.015 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 244 +L+ +A VG A + YW+S PNTP+P + S LL Sbjct: 8 VLSLFCLAFVGITATSSGEDYWQSIWPNTPLPKTFSDLL 46
>RD22_ARATH (Q08298) Dehydration-responsive protein RD22 precursor| Length = 392 Score = 37.0 bits (84), Expect = 0.020 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 110 RLVAAGILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 244 RL +L ++ ++ A P +YW +ALPNTP+P+SL LL Sbjct: 4 RLPLICLLGSFMVVAIA--ADLTPERYWSTALPNTPIPNSLHNLL 46
>SVF30_VICFA (P09059) Unknown seed protein 30.1 precursor (VF30.1)| Length = 268 Score = 35.8 bits (81), Expect = 0.044 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQL 241 +L+ +A VG A + YW+S PNTP+P + S L Sbjct: 8 VLSLFCLAFVGITATSSGEDYWQSIWPNTPLPKTFSDL 45
>EA87_VICFA (P21746) Embryonic abundant protein USP87 precursor| Length = 268 Score = 35.8 bits (81), Expect = 0.044 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 244 +L+ +A VG A YW+S PNTP+P + S +L Sbjct: 8 VLSLFCLAFVGITATSPREDYWQSIWPNTPLPKTFSDML 46
>GID_DEIRA (Q9RXU7) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 465 Score = 31.2 bits (69), Expect = 1.1 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = -1 Query: 412 ADADRSPAGLGAARLHVDADATLAHIDRRAPRHPMARV 299 ADA R PAG A VD DA AH+ + HP+ V Sbjct: 84 ADASRVPAGNALA---VDRDAFSAHVTEQVKNHPLIEV 118
>PPSA_MYCTU (Q10977) Phenolpthiocerol synthesis polyketide synthase ppsA| Length = 1876 Score = 31.2 bits (69), Expect = 1.1 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 119 AAGILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLLDTQ 253 AAGI F+ H P Q++E+A P+ P +++DTQ Sbjct: 452 AAGIAGFIKTVLAVQHGQIPPNQHFETANPHIPFTDLRMKVVDTQ 496
>KLK9_HUMAN (Q9UKQ9) Kallikrein-9 precursor (EC 3.4.21.-) (Kallikrein-like| protein 3) (KLK-L3) Length = 250 Score = 30.8 bits (68), Expect = 1.4 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 Query: 167 HGFLPTRSVGRQECRLRRAYPWRAG 93 HG+ TR++G +ECR + PW+AG Sbjct: 16 HGWADTRAIGAEECR-PNSQPWQAG 39
>SELA_GEOSL (P61736) L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)| (Cysteinyl-tRNA(Sec) selenium transferase) (Selenocysteine synthase) (Selenocysteinyl-tRNA(Sec) synthase) Length = 462 Score = 30.8 bits (68), Expect = 1.4 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = -1 Query: 304 RVNMDAARADVHRRASGLRVEELREGAWHGSVGKSRLPVLPRSTSC 167 R +DA RA+ RA LR ++L +GA G VG+ + RST+C Sbjct: 36 RTALDALRAEA--RAGSLREQDLADGAVAGRVGRE----VARSTAC 75
>TRUD_XANAC (Q8PLR6) tRNA pseudouridine synthase D (EC 5.4.99.-) (tRNA-uridine| isomerase D) (tRNA pseudouridylate synthase D) Length = 369 Score = 29.3 bits (64), Expect = 4.1 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -1 Query: 367 HVDAD-ATL--AHIDRRAPRHPMARVNMDAARADVHRRASGLRVEELREGAWHGSV 209 HV AD TL A RR RH + + AAR+ + R G RV +G+W G++ Sbjct: 182 HVQADDGTLLPAPTSRRRLRHDQRSMLLSAARSALFNRVLGARV---AQGSWDGAL 234
>IPOU_DROME (P24350) Inhibitory POU protein (I-POU) (Abnormal chemosensory jump| 6 protein) Length = 396 Score = 28.9 bits (63), Expect = 5.4 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -1 Query: 391 AGLGAARLHVDADATLAHIDRRAPRHPMARVNMDAARADVHRRASGLRV 245 A + AA LH D D ++ A R R+ + +ADV + + L++ Sbjct: 212 AAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKL 260
>OSP4_PEA (P17771) Organ-specific protein P4| Length = 130 Score = 28.9 bits (63), Expect = 5.4 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLLD 247 + FL++A+V S + G+YW+ + + MP + LLD Sbjct: 13 LFLFLIVANVESR--KDVGEYWKLVMKDQDMPEEIQGLLD 50
>G6PI2_CHRVO (Q7NVH4) Glucose-6-phosphate isomerase 2 (EC 5.3.1.9) (GPI 2)| (Phosphoglucose isomerase 2) (PGI 2) (Phosphohexose isomerase 2) (PHI 2) Length = 550 Score = 28.9 bits (63), Expect = 5.4 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -1 Query: 373 RLHVDADATLAHIDRRAPRHPMARVNMDAARADVHRRASGLR--VEELREGAWHGSVGK 203 R++V + ++ H R P + ADVH+ + L+ E++REG W G G+ Sbjct: 89 RINVSENRSVLHTALRLPAGARLDLEGHNVAADVHQVLARLKDFSEQVREGRWLGFAGQ 147
>ADA15_RAT (Q9QYV0) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) (CRII-7) Length = 816 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 127 HSCLPTDRVGRKPC-SSCSGAILGVC-SSQHSH 219 H C P D +G + C S C G GVC SS+H H Sbjct: 646 HRCQPVDLLGAQECRSKCHGH--GVCDSSRHCH 676
>AMPD2_HUMAN (Q01433) AMP deaminase 2 (EC 3.5.4.6) (AMP deaminase isoform L)| Length = 879 Score = 28.5 bits (62), Expect = 7.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 137 RQECRLRRAYPWRAGQRAAMRKLTAGPSQCEDD 39 R C L ++ P AG+R + GPS+C D Sbjct: 12 RSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSD 44
>GUAA_IDILO (Q5QWW5) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 525 Score = 28.5 bits (62), Expect = 7.1 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 277 DVHRRASGLRVEELREGAWHGSVGKSRLPVLP-RSTSCMASYRR 149 D+ RRA + +EEL W+ V ++ LP RS M R+ Sbjct: 422 DLLRRADAIFIEELHNADWYNKVSQAFAVFLPVRSVGVMGDQRK 465
>G6PI1_STRCO (O88015) Glucose-6-phosphate isomerase 1 (EC 5.3.1.9) (GPI 1)| (Phosphoglucose isomerase 1) (PGI 1) (Phosphohexose isomerase 1) (PHI 1) Length = 550 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -1 Query: 373 RLHVDADATLAHIDRRAPRHPMARVNMDAARADVHR---RASGLRVEELREGAWHGSVGK 203 R+++ D + H RAPR + V+ + VH + +G + +R G W G G+ Sbjct: 88 RINITEDRAVLHTALRAPRDAVIEVDGENVVPQVHAVLDKMAGF-ADRVRSGEWTGHTGR 146
>CHD6_HUMAN (Q8TD26) Chromodomain-helicase-DNA-binding protein 6 (EC 3.6.1.-)| (ATP-dependent helicase CHD6) (CHD-6) (Radiation-induced gene B protein) Length = 2715 Score = 28.1 bits (61), Expect = 9.2 Identities = 25/77 (32%), Positives = 30/77 (38%), Gaps = 2/77 (2%) Frame = -3 Query: 287 RPSRRSPTCLRLACRGVERGSLAWECWEEQTPSIAPEHELHGFLPTRSVGR--QECRLRR 114 +P +R P C V S EE+ P+I E L GFLP E LR Sbjct: 2382 KPKQRRPRCKEPGKLDVSSLS-----GEERVPAIPKEPGLRGFLPENKFNHTLAEPILRD 2436 Query: 113 AYPWRAGQRAAMRKLTA 63 P R G+R L A Sbjct: 2437 TGPRRRGRRPRSELLKA 2453
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 28.1 bits (61), Expect = 9.2 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 312 PWPASTWTPPEPTFTDVPPA 253 P P+ T++PP PT++ PP+ Sbjct: 276 PQPSPTYSPPPPTYSPPPPS 295
>G6PI2_STRCO (Q9Z523) Glucose-6-phosphate isomerase 2 (EC 5.3.1.9) (GPI 2)| (Phosphoglucose isomerase 2) (PGI 2) (Phosphohexose isomerase 2) (PHI 2) Length = 551 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -1 Query: 373 RLHVDADATLAHIDRRAPRHPMARVNMDAARADVHR---RASGLRVEELREGAWHGSVGK 203 R+++ D + H RAPR + V+ + VH + +G + +R G W G G+ Sbjct: 89 RINITEDRAVLHTALRAPRDAVIEVDGENVVPQVHAVLDKMAGF-ADRVRTGEWTGHTGR 147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,627,984 Number of Sequences: 219361 Number of extensions: 1025186 Number of successful extensions: 3475 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 3301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3467 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)