| Clone Name | baet63d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FUCO1_ARATH (Q8GW72) Alpha-L-fucosidase 1 precursor (EC 3.2.1.51... | 41 | 7e-04 | 2 | FUCO1_ORYSA (Q7XUR3) Putative alpha-L-fucosidase 1 precursor (EC... | 40 | 0.002 | 3 | SC11A_MOUSE (Q9R053) Sodium channel protein type 11 alpha subuni... | 28 | 6.2 |
|---|
>FUCO1_ARATH (Q8GW72) Alpha-L-fucosidase 1 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase) (Alpha-1,3/4-fucosidase) (AtFUC1) Length = 506 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 156 TAAQLAWQRREVIMFFHFGMNTFTDVERGTG 248 ++ QL WQ + MF HFG NTFTD E GTG Sbjct: 39 SSQQLQWQLGSMAMFLHFGPNTFTDSEWGTG 69
>FUCO1_ORYSA (Q7XUR3) Putative alpha-L-fucosidase 1 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase) Length = 517 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +3 Query: 162 AQLAWQRREVIMFFHFGMNTFTDVERGTGAED 257 AQL WQ E+ +F HFG NTFTD E G+ D Sbjct: 43 AQLQWQLSEMALFLHFGPNTFTDSEWGSVRAD 74
>SC11A_MOUSE (Q9R053) Sodium channel protein type 11 alpha subunit (Sodium channel| protein type XI alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.9) (Sensory neuron sodium channel 2) (NaN) Length = 1765 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 2/25 (8%) Frame = +3 Query: 189 VIMFFH--FGMNTFTDVERGTGAED 257 ++MF + FGMN F+ V+RG+G +D Sbjct: 1485 LVMFIYAIFGMNWFSKVKRGSGIDD 1509 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,433,936 Number of Sequences: 219361 Number of extensions: 129228 Number of successful extensions: 409 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)