| Clone Name | baet62h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PKHA4_HUMAN (Q9H4M7) Pleckstrin homology domain-containing famil... | 28 | 4.6 |
|---|
>PKHA4_HUMAN (Q9H4M7) Pleckstrin homology domain-containing family A member 4| (Phosphoinositol 3-phosphate-binding protein 1) (PEPP-1) Length = 779 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +3 Query: 189 DPRVVRRSGNEVLWQLPPGPP--RADVFVAPG 278 +PR SG+ QLPP PP RA + + PG Sbjct: 320 EPRTQAHSGSPTYLQLPPRPPGTRASMVLLPG 351 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,689,001 Number of Sequences: 219361 Number of extensions: 201372 Number of successful extensions: 845 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 845 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)