| Clone Name | baet61f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VSX1_CHICK (Q9IAL2) Visual system homeobox 1 (Transcription fact... | 37 | 0.018 | 2 | RUSC2_HUMAN (Q8N2Y8) RUN and SH3 domain-containing protein 2 | 28 | 6.4 | 3 | IASPP_MOUSE (Q5I1X5) RelA-associated inhibitor (Inhibitor of ASP... | 28 | 6.4 |
|---|
>VSX1_CHICK (Q9IAL2) Visual system homeobox 1 (Transcription factor VSX1)| (Homeobox protein Chx10-1) Length = 350 Score = 36.6 bits (83), Expect = 0.018 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 7/59 (11%) Frame = +1 Query: 67 SPSP---RFQPPQAGKQEFSARIRARA----DLRGFRAALSAPCTSDPGPLGSWEGGGA 222 +PSP R P+ + A +RA+ DL G A L P + PGP G +EGGGA Sbjct: 25 APSPASVRSALPERSARPGGAGLRAKGFAITDLLGLEAELQPPPGAAPGPAGGYEGGGA 83
>RUSC2_HUMAN (Q8N2Y8) RUN and SH3 domain-containing protein 2| Length = 1516 Score = 28.1 bits (61), Expect = 6.4 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +1 Query: 88 PPQAGKQEFSARIRARADLRGFRAALSAPCTSDPGPLGSW 207 P +G+ + S RA RG R A S P TS P PLGS+ Sbjct: 744 PAPSGEPQAST---PRATGRGARKAGSEPETSRPSPLGSY 780
>IASPP_MOUSE (Q5I1X5) RelA-associated inhibitor (Inhibitor of ASPP protein)| (Protein iASPP) (PPP1R13B-like protein) (NFkB-interacting protein 1) Length = 824 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 221 APPPSQDPRGPGS-EVHGAERAARNPRKSARARI 123 APP S P P S E+ R +PRK+ RAR+ Sbjct: 588 APPQSSPPEQPQSMEMRSVLRKVGSPRKARRARL 621 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.134 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,846,611 Number of Sequences: 219361 Number of extensions: 544421 Number of successful extensions: 2187 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2187 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)