| Clone Name | baet61d05 |
|---|---|
| Clone Library Name | barley_pub |
>PIGT_MOUSE (Q8BXQ2) GPI transamidase component PIG-T precursor| (Phosphatidylinositol-glycan biosynthesis, class T protein) (Neuronal development-associated protein 7) Length = 582 Score = 29.6 bits (65), Expect = 2.3 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +2 Query: 2 PSELGDQCSHHRLRLLKLIFR*QFLSGRQWLTKFRRSPRPSQVWGVW 142 P LG S + LR L L F F R W F ++P +++W VW Sbjct: 74 PKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELW-VW 119
>SYFA_CLOTE (Q891T7) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 339 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 109 LTKAFSGLGGLGVDERTMVAALAN 180 LTK G+GGL +ER +V LAN Sbjct: 39 LTKILRGMGGLSAEERPIVGKLAN 62
>PIGT_HUMAN (Q969N2) GPI transamidase component PIG-T precursor| (Phosphatidylinositol-glycan biosynthesis, class T protein) Length = 578 Score = 29.6 bits (65), Expect = 2.3 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +2 Query: 2 PSELGDQCSHHRLRLLKLIFR*QFLSGRQWLTKFRRSPRPSQVWGVW 142 P LG S + LR L L F F R W F ++P +++W VW Sbjct: 70 PKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELW-VW 115
>XERC_NEIMB (Q9JXV6) Tyrosine recombinase xerC| Length = 301 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 85 TMADEVQALTKAFSGLGGLGVDERTMVAALANWRK 189 T D VQAL + L G G+ ERT+ L++WR+ Sbjct: 53 TRGDFVQALRR----LSGRGLGERTLARKLSSWRQ 83
>SYFA_GEOMG (Q39VS5) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 338 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 106 ALTKAFSGLGGLGVDERTMVAALAN 180 ALT GLG L +ER +V LAN Sbjct: 38 ALTAVMKGLGALSAEERPVVGQLAN 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,233,543 Number of Sequences: 219361 Number of extensions: 226352 Number of successful extensions: 777 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)