| Clone Name | baet61b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YK16_YEAST (P36130) Hypothetical 74.7 kDa Trp-Asp repeats-contai... | 30 | 2.3 | 2 | LIN23_CAEEL (Q09990) F-box/WD-repeat protein lin-23 (Abnormal ce... | 28 | 5.2 |
|---|
>YK16_YEAST (P36130) Hypothetical 74.7 kDa Trp-Asp repeats-containing protein| in DAL80-GAP1 intergenic region Length = 659 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 27 DGVILKWIQRVGYGGRLIRKNNTQIKCFVATEEELITSGYDNKV 158 DG++ W RVG RL+ + I E+L+T DN V Sbjct: 524 DGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSV 567
>LIN23_CAEEL (Q09990) F-box/WD-repeat protein lin-23 (Abnormal cell lineage| protein 23) Length = 665 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = +3 Query: 3 RTMLSTSYDGVILKWIQRVGYGGRLIRKNNTQIKCFVATEEELITSGYDNKV 158 R ++S S D I W G R++ + ++C E+ +++ YD K+ Sbjct: 396 RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKI 447 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,913,541 Number of Sequences: 219361 Number of extensions: 420338 Number of successful extensions: 960 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)