| Clone Name | baet60g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ORK1_DROME (Q94526) Open rectifier potassium channel protein 1 (... | 32 | 0.58 | 2 | IE63_HHV1E (P36295) Transcriptional regulator IE63 (VMW63) (ICP27) | 28 | 8.4 | 3 | BIN1_HUMAN (O00499) Myc box-dependent-interacting protein 1 (Bri... | 28 | 8.4 | 4 | IE63_HHV11 (P10238) Transcriptional regulator IE63 (VMW63) (ICP27) | 28 | 8.4 |
|---|
>ORK1_DROME (Q94526) Open rectifier potassium channel protein 1 (Two pore| domain potassium channel Ork1) Length = 1001 Score = 31.6 bits (70), Expect = 0.58 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 107 RTPPAPYEKSKSLGSGGSMVARLKLXGIDGRAPP 208 R PP P+E + SL SGG + + DG PP Sbjct: 599 RGPPPPFESNGSLASGGGGLTNMGFQMEDGATPP 632
>IE63_HHV1E (P36295) Transcriptional regulator IE63 (VMW63) (ICP27)| Length = 511 Score = 27.7 bits (60), Expect = 8.4 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 173 ALRPYSPRNPKTLISHKVPAESYKQHP--PIPGRHRLWLRLG 54 A+RP P +P + S + P + +Q P P P H +W RLG Sbjct: 69 AVRPSRPEDPG-VPSTQTPRPTERQGPNDPQPAPHSVWSRLG 109
>BIN1_HUMAN (O00499) Myc box-dependent-interacting protein 1 (Bridging| integrator 1) (Amphiphysin-like protein) (Amphiphysin II) (Box-dependent myc-interacting protein 1) Length = 593 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 219 GSTPGGALPSIPXSFSLATILPPEPK 142 G+TPG LP P +PP PK Sbjct: 321 GATPGATLPKSPSQLRKGPPVPPPPK 346
>IE63_HHV11 (P10238) Transcriptional regulator IE63 (VMW63) (ICP27)| Length = 512 Score = 27.7 bits (60), Expect = 8.4 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 173 ALRPYSPRNPKTLISHKVPAESYKQHP--PIPGRHRLWLRLG 54 A+RP P +P + S + P + +Q P P P H +W RLG Sbjct: 69 AVRPSRPEDPG-VPSTQTPRPTERQGPNDPQPAPHSVWSRLG 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,101,559 Number of Sequences: 219361 Number of extensions: 633043 Number of successful extensions: 1707 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1704 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)