| Clone Name | baet60g11 |
|---|---|
| Clone Library Name | barley_pub |
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 51.6 bits (122), Expect = 5e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 122 GKAVKDLPSSALFGEARVTMRKTAAKAKPVS 214 GKAVK+LPSSAL G+ARV MRKTAAKAK VS Sbjct: 15 GKAVKNLPSSALIGDARVNMRKTAAKAKQVS 45
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 43.5 bits (101), Expect = 1e-04 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 122 GKAVKDLPSSALFGEARVTMRKTAAKAKPVS 214 GKAV ++PSS LFGEARVTMRKTAAKAKP + Sbjct: 15 GKAV-NVPSS-LFGEARVTMRKTAAKAKPAA 43
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 42.4 bits (98), Expect = 3e-04 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 122 GKAVKDLPSSALFGEARVTMRKTAAKAKPVS 214 GKAV ++PSS+ FGEARVTMRKTAAKAKP + Sbjct: 15 GKAV-NVPSSS-FGEARVTMRKTAAKAKPAA 43
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 41.2 bits (95), Expect = 7e-04 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = +2 Query: 146 SSALFGEARVTMRKTAAKAKPVS 214 SSALFGEAR+TMRKTAAK KP + Sbjct: 21 SSALFGEARITMRKTAAKPKPAA 43
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 40.4 bits (93), Expect = 0.001 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GKAVK PSS+ + G +VTMRKTA+KAKPVS Sbjct: 15 GKAVKLSPSSSEITGNGKVTMRKTASKAKPVS 46
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 40.0 bits (92), Expect = 0.002 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GKAVK PSS+ + G +VTMRKTA+KAKPVS Sbjct: 14 GKAVKLSPSSSEVTGNGKVTMRKTASKAKPVS 45
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 39.7 bits (91), Expect = 0.002 Identities = 22/32 (68%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GKAVK PSS+ + G RVTMRKTA KAKP S Sbjct: 15 GKAVKLSPSSSEITGNGRVTMRKTATKAKPAS 46
>CB2F_LYCES (P14277) Chlorophyll a-b binding protein 3B, chloroplast precursor| (LHCII type I CAB-3B) (LHCP) (Fragments) Length = 267 Score = 38.9 bits (89), Expect = 0.004 Identities = 21/32 (65%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GKAVK PSS+ + G R+TMRKTAAK KP S Sbjct: 15 GKAVKLSPSSSEISGNGRITMRKTAAKPKPAS 46
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 38.9 bits (89), Expect = 0.004 Identities = 22/32 (68%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GKAVK PSS+ + G +VTMRKTA KAKPVS Sbjct: 14 GKAVKLSPSSSEVTGNGKVTMRKTANKAKPVS 45
>CB2E_LYCES (P14276) Chlorophyll a-b binding protein 3A, chloroplast precursor| (LHCII type I CAB-3A) (LHCP) (Fragments) Length = 267 Score = 37.7 bits (86), Expect = 0.008 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GK VK PSS+ + G R+TMRKTAAK KP S Sbjct: 15 GKTVKLAPSSSEITGNGRITMRKTAAKPKPAS 46
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 37.4 bits (85), Expect = 0.011 Identities = 20/32 (62%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GKAVK PSS+ + G +VTMRKT KAKP+S Sbjct: 15 GKAVKLSPSSSEITGNGKVTMRKTVTKAKPLS 46
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 37.4 bits (85), Expect = 0.011 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GKAVK PSS+ + G + TMRKT KAKPVS Sbjct: 15 GKAVKFSPSSSEITGNGKATMRKTVTKAKPVS 46
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 37.4 bits (85), Expect = 0.011 Identities = 21/32 (65%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GKAVK PSS+ + G +VTMRKTA+KAK VS Sbjct: 15 GKAVKLSPSSSEITGNGKVTMRKTASKAKTVS 46
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 37.0 bits (84), Expect = 0.014 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 GK VK PSS+ + G + TMRKTA KAKPVS Sbjct: 15 GKVVKLSPSSSEITGNGKATMRKTATKAKPVS 46
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 35.8 bits (81), Expect = 0.031 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +2 Query: 122 GKAVKDLPSSALFGEARVTMRKTAAKAKPVS 214 GKAV SS + G + TMRKT KAKPVS Sbjct: 15 GKAVNVPSSSQITGNGKATMRKTVTKAKPVS 45
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 34.7 bits (78), Expect = 0.069 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVK-DLPSSALFGEARVTMRKTAAKAKPVS 214 GKAVK SS + G +VTMRKT KAKP S Sbjct: 15 GKAVKLSSSSSEITGNGKVTMRKTVTKAKPAS 46
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 34.3 bits (77), Expect = 0.091 Identities = 19/31 (61%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = +2 Query: 122 GKAVKDLPS-SALFGEARVTMRKTAAKAKPV 211 GKAVK P+ S + GE R+TMRKTA K K V Sbjct: 15 GKAVKLGPTASEIIGEGRITMRKTAGKPKTV 45
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 34.3 bits (77), Expect = 0.091 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +2 Query: 122 GKAVKDLPSSALFGEARVTMRKTAAKAKPVS 214 GKAV SS + +VTMRKT KAKPVS Sbjct: 15 GKAVNVPSSSEITRNGKVTMRKTVTKAKPVS 45
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 33.9 bits (76), Expect = 0.12 Identities = 19/29 (65%), Positives = 24/29 (82%), Gaps = 1/29 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAK 205 GKAVK+L SS+ + G+ARV+MRKTAA K Sbjct: 15 GKAVKNLSSSSEVQGDARVSMRKTAATKK 43
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 33.5 bits (75), Expect = 0.15 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 155 LFGEARVTMRKTAAKAKP 208 +FGE R+TMRKTAAK KP Sbjct: 24 VFGEGRITMRKTAAKPKP 41
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 32.7 bits (73), Expect = 0.26 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKTAAKAKPVS 214 G AVK PSS+ + G + MRKT KAKPVS Sbjct: 15 GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVS 46
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 32.7 bits (73), Expect = 0.26 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +2 Query: 146 SSALFGEARVTMRKTAAKAKPVS 214 ++ +FGE R+TMRK+AAK KP + Sbjct: 18 AAKVFGEGRITMRKSAAKPKPAA 40
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 32.0 bits (71), Expect = 0.45 Identities = 18/29 (62%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +2 Query: 122 GKAVKDLPS-SALFGEARVTMRKTAAKAK 205 GKAVK P+ S + G RVTMRKT AK K Sbjct: 15 GKAVKLSPAASEVLGSGRVTMRKTVAKPK 43
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 31.6 bits (70), Expect = 0.59 Identities = 17/24 (70%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +2 Query: 122 GKAVKDLPSSA-LFGEARVTMRKT 190 GKAVK PSS+ LFG RV+MRKT Sbjct: 15 GKAVKVAPSSSELFGNGRVSMRKT 38
>CB2C_LYCES (P14275) Chlorophyll a-b binding protein 1C, chloroplast precursor| (LHCII type I CAB-1C) (LHCP) (Fragments) Length = 265 Score = 30.8 bits (68), Expect = 1.0 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPS-SALFGEARVTMRKTAAKAKPVS 214 G+AVK PS S + G R+TMRK AK+ P S Sbjct: 15 GQAVKLSPSASEISGNGRITMRKAVAKSAPSS 46
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 30.8 bits (68), Expect = 1.0 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPS-SALFGEARVTMRKTAAKAKPVS 214 G+AVK PS S + G R+TMRK AK+ P S Sbjct: 15 GQAVKLSPSASEISGNGRITMRKAVAKSAPSS 46
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 30.0 bits (66), Expect = 1.7 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +2 Query: 122 GKAVKDLPS-SALFGEARVTMRKTAAKAK 205 GKAV P+ S + G RVTMRKT AK K Sbjct: 15 GKAVNLSPAASEVLGSGRVTMRKTVAKPK 43
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 30.0 bits (66), Expect = 1.7 Identities = 17/30 (56%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 122 GKAVKDLP-SSALFGEARVTMRKTAAKAKP 208 GKAVK P +S +FG RVTMRKT P Sbjct: 15 GKAVKLSPGASEVFGTGRVTMRKTVKPTGP 44
>CB2A_LYCES (P14274) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type I CAB-1A) (LHCP) (Fragments) Length = 265 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 122 GKAVKDLPS-SALFGEARVTMRKTAAKAKPVS 214 G+AVK PS S G R+TMRK AK+ P S Sbjct: 15 GQAVKLSPSASENSGNGRITMRKAVAKSAPSS 46
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 122 GKAVKDLPSSALFGEARVTMRKTAAKAKPVS 214 GK +K PSS G AR TMRK+A K S Sbjct: 18 GKQLKLNPSSQELGAARFTMRKSATTKKVAS 48
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 122 GKAVKDLPSSALFGEARVTMRKTAAK 199 G+A+K PS+ G RV+MRKTA K Sbjct: 15 GQAMKLAPSTPELGVGRVSMRKTAPK 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,214,000 Number of Sequences: 219361 Number of extensions: 334539 Number of successful extensions: 1141 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1139 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)