| Clone Name | baet60g03 |
|---|---|
| Clone Library Name | barley_pub |
>IF2P_METTH (O26359) Probable translation initiation factor IF-2| Length = 594 Score = 29.6 bits (65), Expect = 2.1 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 114 DAEAGSPESVTSRSSPAGEEALSEIERFLMQEEEAAXVEPVDGI-SVDEFIDALFD 278 D AGSP V + EE LSEIE + +EA V D + S++ + L D Sbjct: 317 DVMAGSPLRVVTDPEKVREEILSEIEDIKIDTDEAGVVVKADTLGSLEAVVKILRD 372
>SYT1_CHICK (P47191) Synaptotagmin-1 (Synaptotagmin I) (SytI) (p65)| Length = 424 Score = 29.3 bits (64), Expect = 2.7 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +3 Query: 87 ELLAPPPHLDAEAGSPESVTSRSSPAG----EEALSEIERFLMQE 209 E LA PP A P +VT ++P G E+A S +++ M E Sbjct: 8 EALAAPPATTVAAALPSNVTEPAAPGGGGGKEDAFSNLKKKFMNE 52
>CAS1_STRCL (Q05581) Clavaminate synthase 1 (EC 1.14.11.21) (Clavaminic acid| synthetase 1) (CAS1) (CS1) Length = 323 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 114 DAEAGSPESVTSRSSPAGEEALSEIERFLMQEEEAAXVEPVDGISVDEF 260 D G + + PA +EA++ + + L + EA +EP D + VD F Sbjct: 226 DPFLGYDRELLAPEDPADKEAVAALSKALDEVTEAVYLEPGDLLIVDNF 274
>FOXM1_RAT (P97691) Forkhead box protein M1 (Winged helix factor from INS-1| cells) (INS-1 winged helix) Length = 759 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 Query: 96 APPPHLDAEAGSPE 137 +PPPHL+A+ GSPE Sbjct: 689 SPPPHLEAKPGSPE 702
>ICAL_HUMAN (P20810) Calpastatin (Calpain inhibitor) (Sperm BS-17 component)| Length = 708 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 75 SAVSELLAPPPHLDAEAGSPESVTSRSSPAGEEALSEIERFLMQEE 212 +A+SE+++ P +AG+P TS+S ++AL ++ L Q + Sbjct: 537 AAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQ 582
>TRI16_HUMAN (O95361) Tripartite motif protein 16 (Estrogen-responsive B box| protein) Length = 564 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +3 Query: 99 PPPHLDAEAGSPESVTSRSSPAGEEALSEIERFLMQEEEAAXVEPVDGISVDEFIDALFD 278 PP L ++GSP + +SP EE + E+ + EE G E + L D Sbjct: 19 PPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDSDSAEQGDPAGEGKEVLCD 78
>ARPT2_PSESM (Q6LAD6) Cysteine protease avirulence protein avrRpt2 precursor (EC| 3.4.22.-) (Avirulence protein avrRpt2) Length = 255 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 126 GSPESVTSRSSPAGEEALSEIERFLMQE 209 G PE R PAG + S++ERF+ E Sbjct: 141 GLPELYEGREGPAGLQDFSDVERFIHNE 168 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.107 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,807,639 Number of Sequences: 219361 Number of extensions: 305668 Number of successful extensions: 1812 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1812 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)