| Clone Name | baet60e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FL3H_VITVI (P41090) Naringenin,2-oxoglutarate 3-dioxygenase (EC ... | 29 | 3.7 | 2 | ATS9_HUMAN (Q9P2N4) ADAMTS-9 precursor (EC 3.4.24.-) (A disinteg... | 29 | 3.7 | 3 | MK67I_MOUSE (Q91VE6) MKI67 FHA domain-interacting nucleolar phos... | 28 | 4.8 | 4 | HEMH_PROFR (P72183) Ferrochelatase (EC 4.99.1.1) (Protoheme ferr... | 28 | 6.3 | 5 | PHD1_SCHPO (O13298) Histone deacetylase phd1 | 28 | 6.3 |
|---|
>FL3H_VITVI (P41090) Naringenin,2-oxoglutarate 3-dioxygenase (EC 1.14.11.9)| (Flavonone-3-hydroxylase) (F3H) (FHT) Length = 364 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 73 F*FPVRIRTVKAWPIDPLDLRSLKLEVSEKL 165 F +P+R R WP P RS+ E SEKL Sbjct: 135 FSYPLRTRDYSRWPDKPEGWRSVTQEYSEKL 165
>ATS9_HUMAN (Q9P2N4) ADAMTS-9 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 9) (ADAM-TS 9) (ADAM-TS9) Length = 1935 Score = 28.9 bits (63), Expect = 3.7 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 188 PQASYPCGNFSDTSSFKLRRSKGSIGHAFTVR-IRTGNQNQTSFY 57 PQA Y F F L + G I FTV + T NQT FY Sbjct: 96 PQAHYRLSAFGQQFLFNLTANAGFIAPLFTVTLLGTPGVNQTKFY 140
>MK67I_MOUSE (Q91VE6) MKI67 FHA domain-interacting nucleolar phosphoprotein| (Nucleolar protein interacting with the FHA domain of pKI-67) (mNIFK) Length = 317 Score = 28.5 bits (62), Expect = 4.8 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 170 CGNFSDTSSFKLRRSKGSIGHAFTVRIRTGNQNQTSFYPFVPHEISVLV 24 C F D S F+L RSK RTGN +F F +++ +V Sbjct: 67 CAQFGDISRFRLSRSK-----------RTGNSKGYAFVEFESEDVAKIV 104
>HEMH_PROFR (P72183) Ferrochelatase (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme| synthetase) Length = 352 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 63 ARLILISSTNTNRESVAYRSFRSSEFEARGVRKVTT 170 AR I + N NR S+ Y ++ ++RG+R+V T Sbjct: 71 ARGIDVPIANANRHSMPYMDQALADLQSRGIRRVLT 106
>PHD1_SCHPO (O13298) Histone deacetylase phd1| Length = 434 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/61 (24%), Positives = 27/61 (44%) Frame = -3 Query: 188 PQASYPCGNFSDTSSFKLRRSKGSIGHAFTVRIRTGNQNQTSFYPFVPHEISVLVELILG 9 P+ S P S F R K + + ++ GN + +P PH I++ L++G Sbjct: 4 PETSTPYEQVEKGSFFSFRPQKKRVTYHLDEQV--GNYHYGDKHPMKPHRITITNHLVMG 61 Query: 8 H 6 + Sbjct: 62 Y 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,950,332 Number of Sequences: 219361 Number of extensions: 504386 Number of successful extensions: 1312 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1312 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)