| Clone Name | baet59g09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KLF14_HUMAN (Q8TD94) Krueppel-like factor 14 (Transcription fact... | 32 | 0.44 | 2 | ZBP2_CHICK (Q8UVD9) Zipcode-binding protein 2 | 28 | 4.8 | 3 | RIN2_HUMAN (Q8WYP3) Ras and Rab interactor 2 (Ras interaction/in... | 28 | 6.3 | 4 | EBNA6_EBV (P03204) Epstein-Barr nuclear antigen 6 (EBV nuclear a... | 28 | 8.3 |
|---|
>KLF14_HUMAN (Q8TD94) Krueppel-like factor 14 (Transcription factor BTEB5)| (Basic transcription element-binding protein 5) (BTE-binding protein 5) Length = 323 Score = 32.0 bits (71), Expect = 0.44 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +1 Query: 118 GANGARR*HGSRVGYREHEEAHVPGPAPAEPTHVPQ 225 GA GA GS VG H E+ +PGP P+ P VPQ Sbjct: 34 GAGGAA---GSEVG-AAHPESALPGPGPSGPASVPQ 65
>ZBP2_CHICK (Q8UVD9) Zipcode-binding protein 2| Length = 769 Score = 28.5 bits (62), Expect = 4.8 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = +1 Query: 46 NLFPRSKPLFLPSPNGQEKXXXXXGANGARR*HGSRVGYREHEEAHVPGPAPAEP 210 N +P+ +P P+P+ K N A GY H PGP P +P Sbjct: 608 NTYPQWQP---PAPHDPSKAAAAADPNAAW------AGYYSHYYQQPPGPVPGQP 653
>RIN2_HUMAN (Q8WYP3) Ras and Rab interactor 2 (Ras interaction/interference| protein 2) (Ras inhibitor JC265) (Ras association domain family 4) Length = 895 Score = 28.1 bits (61), Expect = 6.3 Identities = 24/82 (29%), Positives = 31/82 (37%), Gaps = 17/82 (20%) Frame = +1 Query: 13 TAPYKARTRTQNLFPRS--------------KPLFLPSPNGQEKXXXXXGANGARR*HGS 150 T+P ART TQ P + KP +P P +++ GA+ G Sbjct: 321 TSPRLARTETQTSMPETVNHNKHGNVALPGTKPTPIPPPRLKKQASFLEAEGGAKTLSGG 380 Query: 151 RVGYREHEE---AHVPGPAPAE 207 R G E A PG AP E Sbjct: 381 RPGAGPELELGTAGSPGGAPPE 402
>EBNA6_EBV (P03204) Epstein-Barr nuclear antigen 6 (EBV nuclear antigen 6)| (EBNA-6) (EBNA-3C) (EBNA-4B) Length = 992 Score = 27.7 bits (60), Expect = 8.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 169 HEEAHVPGPAPAEPTHVPQRRR 234 H+ VP P P +PT P RRR Sbjct: 478 HQPPPVPKPVPVKPTPPPSRRR 499 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,349,034 Number of Sequences: 219361 Number of extensions: 408152 Number of successful extensions: 1756 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1731 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)