| Clone Name | baet59g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CATA_STRCO (Q9Z598) Catalase (EC 1.11.1.6) | 29 | 3.9 | 2 | MMP3_HUMAN (P08254) Stromelysin-1 precursor (EC 3.4.24.17) (Matr... | 28 | 6.6 | 3 | Y567_BUCAP (Q8K902) Hypothetical transport protein BUsg567 | 28 | 6.6 |
|---|
>CATA_STRCO (Q9Z598) Catalase (EC 1.11.1.6)| Length = 487 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +2 Query: 5 HQGPSQTPSPLSTAMDADADTVVFEAPAHFR---FYKSGKIERL 127 + GP++T +PL+ + T EAP H + F ++G + RL Sbjct: 390 YDGPAETGTPLAAPLAVSGHTGTHEAPLHTKDDHFVQAGALYRL 433
>MMP3_HUMAN (P08254) Stromelysin-1 precursor (EC 3.4.24.17) (Matrix| metalloproteinase-3) (MMP-3) (Transin-1) (SL-1) Length = 477 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +2 Query: 137 PILPAGVDEATGVTSKDVV 193 P LP+GVD A VTSKD+V Sbjct: 334 PSLPSGVDAAYEVTSKDLV 352
>Y567_BUCAP (Q8K902) Hypothetical transport protein BUsg567| Length = 413 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = -3 Query: 123 RSILPLL*KRKCAGASNTTVSASASMAVESGDGVWLGP 10 +SILP+ K+ C A+ +++S SA+ A S +++GP Sbjct: 56 QSILPVFSKQFCLTATESSLSLSAATATMSIGTLFIGP 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.128 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,683,892 Number of Sequences: 219361 Number of extensions: 364817 Number of successful extensions: 806 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)