| Clone Name | baet59e04 |
|---|---|
| Clone Library Name | barley_pub |
>KATAM_ARATH (Q7XJ98) Xyloglucan galactosyltransferase KATAMARI 1 (EC 2.4.1.-)| (MURUS3 protein) Length = 619 Score = 37.0 bits (84), Expect = 0.013 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 133 DSSDPCAGRRIHIRDLPPRFNTHLLRHC 216 + SDPC G+ I++ +LP +FN +LR C Sbjct: 146 NKSDPCGGKYIYVHNLPSKFNEDMLRDC 173
>ABI1_RAT (Q9QZM5) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Eps8 SH3| domain-binding protein) (Eps8-binding protein) (e3B1) Length = 475 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +2 Query: 26 SLSLARPTPP----TPRCPILXXXXXXXXXXAQSPETPPP 133 S+S+A P PP TP+ P+ A SP PPP Sbjct: 326 SISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPP 365
>ABI1_HUMAN (Q8IZP0) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Spectrin| SH3 domain-binding protein 1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (e3B1) (Nap1-binding protein) (Nap1BP) (Abl-binding protein 4) (AblBP4) Length = 507 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +2 Query: 26 SLSLARPTPP----TPRCPILXXXXXXXXXXAQSPETPPP 133 S+S+A P PP TP+ P+ A SP PPP Sbjct: 358 SISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPP 397
>ABI1_MOUSE (Q8CBW3) Abl interactor 1 (Abelson interactor 1) (Abi-1) (Spectrin| SH3 domain-binding protein 1) (Eps8 SH3 domain-binding protein) (Eps8-binding protein) (e3B1) (Ablphilin-1) Length = 480 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +2 Query: 26 SLSLARPTPP----TPRCPILXXXXXXXXXXAQSPETPPP 133 S+S+A P PP TP+ P+ A SP PPP Sbjct: 331 SISVAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPP 370
>SYNJ2_RAT (O55207) Synaptojanin-2 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 2) Length = 1496 Score = 28.5 bits (62), Expect = 4.8 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 23 VSLSLARPTPPTPRCPILXXXXXXXXXXAQSPETPPPIRQTPARAA 160 ++ S + P+PP P P+L A SPET P R T AA Sbjct: 1367 LTCSSSSPSPPKPDTPLLYPQMALGTSSAISPETDGP-RVTEPEAA 1411 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.132 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,550,349 Number of Sequences: 219361 Number of extensions: 410807 Number of successful extensions: 1560 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1556 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)