| Clone Name | baet59d01 |
|---|---|
| Clone Library Name | barley_pub |
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 38.1 bits (87), Expect = 0.006 Identities = 22/49 (44%), Positives = 24/49 (48%), Gaps = 9/49 (18%) Frame = +1 Query: 139 GDSGR---------VGLAKSTRRDVAVQAKGSWLPGLQSPAYLDGSLAG 258 G SGR +G + T KG WLPGL SP YL GSLAG Sbjct: 25 GSSGRLNRDLSFTSIGSSAKTSSFKVEAKKGEWLPGLASPDYLTGSLAG 73
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 32.3 bits (72), Expect = 0.33 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 163 AKSTRRDVAVQAKGSWLPGLQSPAYLDGSLAG 258 A + + + W PG +SP YLDGSL G Sbjct: 40 ASPKKAKTVISDRPLWFPGAKSPEYLDGSLVG 71
>MA1C1_HUMAN (Q9NR34) Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC (EC| 3.2.1.113) (Processing alpha-1,2-mannosidase IC) (Alpha-1,2-mannosidase IC) (Mannosidase alpha class 1C member 1) (HMIC) Length = 630 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 218 PGSQDPLAWTATSRRVDLASPTRPESPR 135 PG DP +W + RR TRP PR Sbjct: 91 PGEDDPSSWASPRRRKGGLRRTRPTGPR 118
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 166 KSTRRDVAVQAKGSWLPGLQSPAYLDGSLAG 258 KS ++ V + W PG SP +LDGSL G Sbjct: 45 KSAKKTVTTD-RPLWYPGAISPDWLDGSLVG 74
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 28.1 bits (61), Expect = 6.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 208 WLPGLQSPAYLDGSLAG 258 W+PG P+YLDGS G Sbjct: 49 WMPGQPRPSYLDGSAPG 65
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 6/33 (18%) Frame = +1 Query: 178 RDVAVQAKGS------WLPGLQSPAYLDGSLAG 258 R VAV A + W PG P +LDGSL G Sbjct: 52 RSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPG 84
>DOPO_HUMAN (P09172) Dopamine beta-hydroxylase precursor (EC 1.14.17.1)| (Dopamine beta-monooxygenase) Length = 603 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +3 Query: 60 EDVVGQCPRSRGRSPAG 110 E+ QCP S+GRSPAG Sbjct: 576 EEPTPQCPTSQGRSPAG 592
>CB29_CHLRE (Q93WD2) Chlorophyll a-b binding protein CP29| Length = 279 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 145 SGRVGLAKSTRRDVAVQAKGSWLPGLQSPAYLDGSLAG 258 SG VG K Q WLP P +LDGSL G Sbjct: 38 SGGVGYRK-------YQGDALWLPNTTRPEWLDGSLPG 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,911,770 Number of Sequences: 219361 Number of extensions: 334925 Number of successful extensions: 1065 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1065 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)