| Clone Name | baet59b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYB_THEPA (Q36099) Cytochrome b | 30 | 1.7 | 2 | Y006_RICPR (Q9ZED6) Hypothetical protein RP006 | 28 | 8.6 |
|---|
>CYB_THEPA (Q36099) Cytochrome b| Length = 363 Score = 30.0 bits (66), Expect = 1.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 12 FFSFVGPRAGHFYSALSLAWQWPRGRVLLLLITVCA 119 FF F+ G +YS+ + W W G V+L+L V A Sbjct: 82 FFMFIHIIKGMWYSSKYMPWSWYSGIVILILSIVIA 117
>Y006_RICPR (Q9ZED6) Hypothetical protein RP006| Length = 706 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 95 AASDHRVC*SIRRACAEQQQEPL 163 AA+ HR+C +AC Q+Q+P+ Sbjct: 3 AATGHRICNDCSKACIYQKQDPV 25 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,010,121 Number of Sequences: 219361 Number of extensions: 258371 Number of successful extensions: 523 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)