| Clone Name | baet59b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ADA2B_BOVIN (O77700) Alpha-2B adrenergic receptor (Alpha-2B adre... | 28 | 8.6 | 2 | ST17B_MOUSE (Q8BG48) Serine/threonine-protein kinase 17B (EC 2.7... | 28 | 8.6 |
|---|
>ADA2B_BOVIN (O77700) Alpha-2B adrenergic receptor (Alpha-2B adrenoceptor)| (Alpha-2B adrenoreceptor) (Fragment) Length = 392 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/16 (75%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = +1 Query: 85 HCR-PRAQGGDGDRES 129 HCR PRA+GG G+RES Sbjct: 190 HCRGPRAKGGPGERES 205
>ST17B_MOUSE (Q8BG48) Serine/threonine-protein kinase 17B (EC 2.7.11.1) (DAP| kinase-related apoptosis-inducing protein kinase 2) Length = 372 Score = 27.7 bits (60), Expect = 8.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 35 AVLYTTASRPHVAQLHCTAGHARKVVMVTERATG 136 AVL S PHV LH +A ++++V E A G Sbjct: 82 AVLELARSCPHVINLHEVYENATEIILVLEYAAG 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,383,619 Number of Sequences: 219361 Number of extensions: 356685 Number of successful extensions: 1170 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1170 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)