| Clone Name | baet59a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EI... | 29 | 3.5 | 2 | ALB32_ARATH (Q8L718) Inner membrane ALBINO3-like protein 2, chlo... | 28 | 6.0 |
|---|
>PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EIICBA component| [Includes: Glucosamine permease IIC component (PTS system glucosamine-specific EIIC component); Glucosamine-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS Length = 631 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 186 IFCAPAVGAAVAYLEEPAKSSRVPSILVGAS 94 IFC PAV A+ + P K + +++ A+ Sbjct: 252 IFCLPAVALAIIHTARPEKKKMISGVMISAA 282
>ALB32_ARATH (Q8L718) Inner membrane ALBINO3-like protein 2, chloroplast| precursor (Ath5) Length = 525 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 1 THHILPSC*AEHAPLLHAPSPS 66 +HH+ PS H+P L +PSPS Sbjct: 23 SHHLKPSSFISHSPPLFSPSPS 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,013,464 Number of Sequences: 219361 Number of extensions: 414857 Number of successful extensions: 1287 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1287 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)