ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet58a07 |
|---|---|
| Clone Library Name | barley_pub |
>PRMA_ANASP (Q8YVT3) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 306 Score = 29.3 bits (64), Expect = 2.8 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +3 Query: 72 TWQLREHSSWASCWRS---PSPMPRQRLSSSAWPSAPTAQGR 188 TWQL + WAS W+ P + + L + AW +P R Sbjct: 79 TWQLIDEEDWASSWKQYWHPQEIGDRFLINPAWLPSPENSDR 120
>IF2_PROMM (Q7V5M4) Translation initiation factor IF-2| Length = 1125 Score = 28.9 bits (63), Expect = 3.7 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +3 Query: 117 SPSPM--PRQRLSSSAWPSAPTAQGRTSRPRKP 209 SP P+ P QR ++S P AP QG+T RP +P Sbjct: 276 SPRPIGGPNQRANTSQRPGAPIRQGKT-RPGQP 307 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 132 PRQRLSSSAWPSAPTAQGRTSRPRKPSTVS 221 PR ++ S P +PTA GR++ P KPS S Sbjct: 208 PRPKIVSR--PQSPTAPGRSAPPAKPSIPS 235
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +3 Query: 114 RSPSPMPRQRLSSSAWPSAPTAQGRTSRPRK--PSTVSRWRS 233 RSPSP P +R S + P P + S PR+ PS R RS Sbjct: 542 RSPSPPPARRRRSPSPPPPPRRRRSPSLPRRRSPSPPPRRRS 583
>CCNL1_BRARE (Q7ZVX0) Cyclin-L1| Length = 498 Score = 28.5 bits (62), Expect = 4.8 Identities = 21/47 (44%), Positives = 24/47 (51%) Frame = +3 Query: 84 REHSSWASCWRSPSPMPRQRLSSSAWPSAPTAQGRTSRPRKPSTVSR 224 R HS S S SP PRQ+ A +P +Q RT R R PS SR Sbjct: 385 RSHSGTYSSHSSHSPSPRQK----ARRPSPISQLRTDRDR-PSETSR 426
>IF2_THEFY (Q47RV1) Translation initiation factor IF-2| Length = 955 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 114 RSPSPMPRQRLSSSAWPSAPTAQGRTSRPRKP 209 + PSP P+ SAP+A G T RP P Sbjct: 67 KKPSPKPQPSPQQQTKASAPSAGGETPRPAVP 98
>ADRB1_PIG (Q28998) Beta-1 adrenergic receptor (Beta-1 adrenoceptor) (Beta-1| adrenoreceptor) Length = 468 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +3 Query: 117 SPSPMPRQRLSSSAWPSAPTAQGRTSRPRKPS 212 SP+P P L ++A +AP A GRTS+ R+PS Sbjct: 273 SPAPSPGSPLPAAA-AAAPVANGRTSK-RRPS 302
>KIFC3_HUMAN (Q9BVG8) Kinesin-like protein KIFC3| Length = 694 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +3 Query: 72 TWQLREHSSWASCWRSPSPMPRQRLSSSAWPSAPTAQGRTSRPRKPSTVSR 224 +W +EH W ++P P R + S+ S + G R +PS SR Sbjct: 642 SWSSQEHLEWEPACQTPQPSARAHSAPSSGTS--SRPGSIRRKLQPSAKSR 690
>RL5_ANOGA (O44248) 60S ribosomal protein L5| Length = 327 Score = 27.7 bits (60), Expect = 8.3 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 84 REHSSWASCWRSPSPMPRQRLS-SSAWP-SAPTAQ-GRTSRPRKPSTVSRW 227 R W SC RSP R R + ++WP S PT++ R R R+P S W Sbjct: 263 RSGGRWPSC-RSPPARRRSRSTRPTSWPRSRPTSKPKRLPRRRRPFFFSSW 312
>SYNPO_MOUSE (Q8CC35) Synaptopodin| Length = 929 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = +3 Query: 99 WASCWRSP------SPMPRQRLSSSAWPSAPTAQGRTSRPRK 206 WASC +SP P P Q LS ++ A R SR K Sbjct: 683 WASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEK 724
>SYNPO_HUMAN (Q8N3V7) Synaptopodin| Length = 929 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = +3 Query: 99 WASCWRSP------SPMPRQRLSSSAWPSAPTAQGRTSRPRK 206 WASC +SP P P Q LS ++ A R SR K Sbjct: 696 WASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEK 737
>SOXB_RHOCA (Q52671) Sarcosine oxidase beta subunit (EC 1.5.3.1) (Sarcosine| oxidase subunit B) (Fragment) Length = 208 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 81 LREHSSWASCWRSPSPMPR 137 LR HS W W SP P R Sbjct: 14 LRYHSGWEKAWASPEPKKR 32
>NFAC3_MOUSE (P97305) Nuclear factor of activated T-cells, cytoplasmic 3| (NF-ATc3) (NFATc3) (T cell transcription factor NFAT4) (NF-AT4) (NFATx) Length = 1075 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 114 RSPSPMPRQRLSSSAWPSAPTAQGRTSRPRKPSTVSRWRSS 236 +SP PR ++ W S A G +SRP P R S+ Sbjct: 239 QSPCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSA 279
>ATX1_HUMAN (P54253) Ataxin-1 (Spinocerebellar ataxia type 1 protein)| Length = 816 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 171 AHLARPTTTNVASALATAIASRTPRTSALVAAMSELLAD 55 + L PT V SA+A+A + TP + + A S LLA+ Sbjct: 145 SQLIPPTANPVTSAVASAAGATTPSQRSQLEAYSTLLAN 183
>SYNPO_RAT (Q9Z327) Synaptopodin| Length = 931 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = +3 Query: 99 WASCWRSP------SPMPRQRLSSSAWPSAPTAQGRTSRPRK 206 WASC +SP P P Q LS ++ A R SR K Sbjct: 685 WASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEK 726 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,534,374 Number of Sequences: 219361 Number of extensions: 630130 Number of successful extensions: 2708 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2698 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
