| Clone Name | baet58a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PYR1_SCHPO (Q09794) Protein ura1 [Includes: Glutamine-dependent ... | 30 | 1.6 | 2 | PROA_LEGPN (P21347) Zinc metalloproteinase precursor (EC 3.4.24.... | 28 | 8.1 | 3 | GLUD1_MOUSE (Q8CIX8) Glutamate--ammonia ligase domain-containing... | 28 | 8.1 | 4 | GLUD1_RAT (Q7TT51) Glutamate--ammonia ligase domain-containing p... | 28 | 8.1 |
|---|
>PYR1_SCHPO (Q09794) Protein ura1 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2244 Score = 30.0 bits (66), Expect = 1.6 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 9/75 (12%) Frame = +1 Query: 31 GWHSLNVNGEVQKRKGLR-------WIPRHPETRKGVASDEMLRGV--ENKHRSGDSQIG 183 GW L VN +G+ + HPE+ G E L V + RS D++ Sbjct: 393 GWKELFVNANDGSNEGIYNTEYPFFSVQFHPESTPGPRDTEFLFDVFIDVVKRSADAKSL 452 Query: 184 QPFKLPAESMSRQET 228 QPFKLP ++ + Sbjct: 453 QPFKLPGGTIEENRS 467
>PROA_LEGPN (P21347) Zinc metalloproteinase precursor (EC 3.4.24.-) (PEP1) (PRO| A) Length = 543 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 216 AHGFSRQFKGLTYLGISGSM 157 +HGF+ Q GL Y G SG M Sbjct: 380 SHGFTEQHSGLEYFGQSGGM 399
>GLUD1_MOUSE (Q8CIX8) Glutamate--ammonia ligase domain-containing protein 1| (Lengsin) (Lens glutamine synthase-like) Length = 563 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 164 DLCLFSTPRSISSLATPFLVSGCLGIHRKPFL 69 D C+F P I+S F S L H +PF+ Sbjct: 263 DFCIFGVPEVINSKTISFPASTLLSNHDQPFM 294
>GLUD1_RAT (Q7TT51) Glutamate--ammonia ligase domain-containing protein 1| (Lengsin) (Lens glutamine synthase-like) Length = 561 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 164 DLCLFSTPRSISSLATPFLVSGCLGIHRKPFL 69 D C+F P I+S F S L H +PF+ Sbjct: 261 DFCIFGVPEVINSKTISFPASTLLSNHDQPFM 292 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,001,223 Number of Sequences: 219361 Number of extensions: 672476 Number of successful extensions: 1560 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1560 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)