| Clone Name | baet57g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PME17_CHICK (Q98917) Melanocyte protein Pmel 17 precursor (115 k... | 30 | 2.4 | 2 | MED6_YEAST (P38782) RNA polymerase II mediator complex subunit 6... | 28 | 7.0 |
|---|
>PME17_CHICK (Q98917) Melanocyte protein Pmel 17 precursor (115 kDa melanosomal| matrix protein) Length = 763 Score = 29.6 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 16 HSAIVSSSTSQAIVSRSNRGGGREAGEMKATA 111 H AIV + A+V+ RGGGR G +K +A Sbjct: 4 HGAIVLLAALLALVTAQQRGGGRSRGGVKGSA 35
>MED6_YEAST (P38782) RNA polymerase II mediator complex subunit 6 (RNA| polymerase II transcriptional regulation mediator 6) Length = 295 Score = 28.1 bits (61), Expect = 7.0 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 1 STAVHHSAIV-SSSTSQAIVSRSNRGGGREAGEMKATAGALLAVV 132 S VH+ +S+T+ A + +N GGG ++ T GA +A V Sbjct: 197 SQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATV 241 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.307 0.116 0.290 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,529,672 Number of Sequences: 219361 Number of extensions: 159773 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 80,573,946 effective HSP length: 20 effective length of database: 76,186,726 effective search space used: 1828481424 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)