| Clone Name | baet57g03 |
|---|---|
| Clone Library Name | barley_pub |
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 100 bits (248), Expect = 1e-21 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAKQVSS SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG Sbjct: 39 AKAKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 84
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 94.7 bits (234), Expect = 6e-20 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +1 Query: 13 RQPSKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 + +K K +SGSPWYG+DRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG Sbjct: 31 KSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 79
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 92.8 bits (229), Expect = 2e-19 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = +1 Query: 31 KQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 KQVSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAG Sbjct: 39 KQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 81
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 92.4 bits (228), Expect = 3e-19 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 10 ARQPSKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 A +P A SSGSPWYG+DRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG Sbjct: 36 AAKPKPA--ASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 83
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 92.4 bits (228), Expect = 3e-19 Identities = 41/46 (89%), Positives = 41/46 (89%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 SKAK VSSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 40 SKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 92.4 bits (228), Expect = 3e-19 Identities = 41/46 (89%), Positives = 41/46 (89%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 SKAK VSSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 39 SKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 92.0 bits (227), Expect = 4e-19 Identities = 42/47 (89%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = +1 Query: 22 SKAKQV-SSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK SSGSPWYG DRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG Sbjct: 37 AKAKPAASSGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 83
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 91.3 bits (225), Expect = 7e-19 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = +1 Query: 28 AKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +K VSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAG Sbjct: 30 SKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 73
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 91.3 bits (225), Expect = 7e-19 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK VSSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 40 TKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 91.3 bits (225), Expect = 7e-19 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK VSSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 40 TKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 85
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 91.3 bits (225), Expect = 7e-19 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK VSSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 39 NKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 91.3 bits (225), Expect = 7e-19 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK VSSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 39 TKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 84
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 91.3 bits (225), Expect = 7e-19 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK VSSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 39 TKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 84
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 90.9 bits (224), Expect = 9e-19 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 1/47 (2%) Frame = +1 Query: 22 SKAKQVS-SGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK + SGSPWYG DRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG Sbjct: 37 AKAKPAAASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 83
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 90.9 bits (224), Expect = 9e-19 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = +1 Query: 28 AKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +K VSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAG Sbjct: 20 SKTVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 63
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 90.1 bits (222), Expect = 1e-18 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK +SSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 40 TKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 89.7 bits (221), Expect = 2e-18 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK SSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 40 TKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 89.7 bits (221), Expect = 2e-18 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +K K SGSPWYG+DRVLYLGPLSG PPSYLTGEFPGDYGWDT G Sbjct: 37 AKPKPARSGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTEG 82
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 89.0 bits (219), Expect = 3e-18 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTA 156 +KAK VSSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTA Sbjct: 40 TKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTA 84
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 89.0 bits (219), Expect = 3e-18 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = +1 Query: 25 KAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 K K +SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAG Sbjct: 36 KPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 80
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 88.2 bits (217), Expect = 6e-18 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 SKAK VSS SPWYG +RV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 40 SKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 87.8 bits (216), Expect = 7e-18 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +1 Query: 43 SGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 SGSPWYGSDRV YLGP SGEPPSYLTGEFPGDYGWDTAG Sbjct: 45 SGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAG 83
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 85.9 bits (211), Expect = 3e-17 Identities = 37/45 (82%), Positives = 38/45 (84%) Frame = +1 Query: 25 KAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 K+ S SPWYG DRVLYLGP SGEPPSYLTGEFPGDYGWDTAG Sbjct: 52 KSVAASIDSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 96
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 85.5 bits (210), Expect = 4e-17 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = +1 Query: 31 KQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 K SSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 44 KVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 86
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 85.5 bits (210), Expect = 4e-17 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 40 SSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +S SPWYG DRVLYLGP SGEPPSYLTGEFPGDYGWDTAG Sbjct: 53 ASTSPWYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAG 92
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 85.5 bits (210), Expect = 4e-17 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = +1 Query: 31 KQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 K SSGSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 45 KVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 87
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 85.5 bits (210), Expect = 4e-17 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +1 Query: 28 AKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 AK V+S SPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 40 AKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 85.1 bits (209), Expect = 5e-17 Identities = 37/45 (82%), Positives = 37/45 (82%) Frame = +1 Query: 25 KAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 K K V S SPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 41 KPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 85
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 85.1 bits (209), Expect = 5e-17 Identities = 37/46 (80%), Positives = 38/46 (82%) Frame = +1 Query: 22 SKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +KAK SS SPWYG DRV YLGP SGE PSYLTGEFP DYGWDTAG Sbjct: 40 TKAKPASSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPSDYGWDTAG 85
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 85.1 bits (209), Expect = 5e-17 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +1 Query: 25 KAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 K+ S SPWYG DRV+YLGP SGEPPSYLTGEFPGDYGWDTAG Sbjct: 52 KSVAASIDSPWYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAG 96
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 84.7 bits (208), Expect = 6e-17 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = +1 Query: 43 SGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 SGSPWYGSDRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 46 SGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 84.7 bits (208), Expect = 6e-17 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = +1 Query: 43 SGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 SGSPWYGSDRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 46 SGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 84
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 83.6 bits (205), Expect = 1e-16 Identities = 36/44 (81%), Positives = 36/44 (81%) Frame = +1 Query: 28 AKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 AK S SPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 40 AKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 83
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 82.0 bits (201), Expect = 4e-16 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = +1 Query: 13 RQPSKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 R+ + K+V GSPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 36 RKTAATKKV--GSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAG 82
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 80.5 bits (197), Expect = 1e-15 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +1 Query: 43 SGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 SGS WYGSDR LYLGP SG PPSYL+GEFPGDYGWDTAG Sbjct: 45 SGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAG 83
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 80.1 bits (196), Expect = 2e-15 Identities = 34/39 (87%), Positives = 34/39 (87%) Frame = +1 Query: 43 SGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S SPWYG DRV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 44 SDSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAG 82
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 78.6 bits (192), Expect = 4e-15 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = +1 Query: 31 KQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 K SS SPW+G D V YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 4 KVASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAG 46
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 70.5 bits (171), Expect = 1e-12 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = +1 Query: 28 AKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 A+ S WYG DRV YLGP S + PSYL GEFPGDYGWDTAG Sbjct: 38 ARFTMSNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAG 81
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = +1 Query: 13 RQPSKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +Q A S+G WYG DR +LGP S P+YLTGEFPGDYGWDTAG Sbjct: 25 KQTKAAPAKSAGIEWYGPDRAKWLGPFSTNTPAYLTGEFPGDYGWDTAG 73
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 69.3 bits (168), Expect = 3e-12 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +1 Query: 55 WYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 WYG DRV YLGP S + PSYL GEFPGDYGWDTAG Sbjct: 50 WYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAG 84
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 69.3 bits (168), Expect = 3e-12 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 28 AKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +K S + WYG+DR +LGP SGE PSYL GEF GDYGWDTAG Sbjct: 43 SKSAGSDTIWYGADRPKFLGPFSGETPSYLNGEFAGDYGWDTAG 86
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 68.9 bits (167), Expect = 4e-12 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG DR YLGP S + PSYLTGEFPGDYGWDTAG Sbjct: 19 SIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 55
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 68.9 bits (167), Expect = 4e-12 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG DR YLGP S + PSYLTGEFPGDYGWDTAG Sbjct: 47 SIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 68.9 bits (167), Expect = 4e-12 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG DR YLGP S + PSYLTGEFPGDYGWDTAG Sbjct: 47 SIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 68.9 bits (167), Expect = 4e-12 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG DR YLGP S + PSYLTGEFPGDYGWDTAG Sbjct: 47 SIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 83
>CB21_SILPR (P12332) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 205 Score = 68.6 bits (166), Expect = 5e-12 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG DR YLGP S + PSYLTGEFPGDYGWDTAG Sbjct: 46 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 82
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 68.6 bits (166), Expect = 5e-12 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG DR YLGP S + PSYLTGEFPGDYGWDTAG Sbjct: 45 SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAG 81
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 68.2 bits (165), Expect = 6e-12 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG DR YLGP S + PSYLTGEFPGDYGWDTAG Sbjct: 47 SIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAG 83
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 67.8 bits (164), Expect = 8e-12 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG+DR +LGP S + PSYLTGEFPGDYGWDTAG Sbjct: 46 SIWYGADRPKFLGPFSEQTPSYLTGEFPGDYGWDTAG 82
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 67.8 bits (164), Expect = 8e-12 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 S WYG DR YLGP S + PSYLTGEFPGDYGWDTAG Sbjct: 47 SIWYGPDRPKYLGPFSEQIPSYLTGEFPGDYGWDTAG 83
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 64.7 bits (156), Expect = 7e-11 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +1 Query: 49 SPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTA 156 S WYG DR YLGP S PSYLTGEFPGDYGWDTA Sbjct: 48 SIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTA 83
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 64.3 bits (155), Expect = 9e-11 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = +1 Query: 31 KQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPG 135 K VSSGSPWYG DRV YLGP SGE PSYLTGEF G Sbjct: 40 KTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFHG 74
>CB2_MALDO (P15773) Chlorophyll a-b binding protein AB10, chloroplast| precursor (LHCII type I CAB-AB10) (LHCP) Length = 268 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 70 RVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 RV YLGP SGE PSYLTGEFPGDYGWDTAG Sbjct: 58 RVKYLGPFSGEWPSYLTGEFPGDYGWDTAG 87
>CB2_DUNTE (P27517) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Frame = +1 Query: 13 RQPSKAKQVSSGSPWYGSDRVLYLGPLS-GEPPSYLTGEFPGDYGWDTAG 159 RQ A + +YG DR +LGP S + P YLTGEFPGDYGWDTAG Sbjct: 19 RQQRMATVPRAAVEFYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDTAG 68
>CB2_CHLRE (P14273) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 58.9 bits (141), Expect = 4e-09 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +1 Query: 40 SSGSPWYGSDRVLYLGPLS-GEPPSYLTGEFPGDYGWDTAG 159 SSG +YG +R +LGP S P+YLTGEFPGDYGWDTAG Sbjct: 31 SSGVEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAG 71
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 57.4 bits (137), Expect = 1e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 88 PLSGEPPSYLTGEFPGDYGWDTAG 159 P SGEPPSYLTGEFPGDYGWDTAG Sbjct: 1 PFSGEPPSYLTGEFPGDYGWDTAG 24
>CB2_DUNSA (P20865) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 273 Score = 43.1 bits (100), Expect = 2e-04 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = +1 Query: 28 AKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 +K SS + +YG D L + P TGEFPGDYGWDTAG Sbjct: 48 SKSSSSANQFYGPDATSGWD-LQHQHPRLPTGEFPGDYGWDTAG 90
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 42.7 bits (99), Expect = 3e-04 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 7/54 (12%) Frame = +1 Query: 19 PSKAKQVSSGSP----WYGSDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAG 159 P+K+K VS S WYG DR ++L G L E P YL GE GDYG+D G Sbjct: 46 PAKSKAVSETSDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFG 99
>CLCL_RALSO (Q8XTT4) Putative chloride channel protein clcB-like| Length = 429 Score = 33.5 bits (75), Expect = 0.16 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 156 GGVPSVVTGELTSQVAWWLAGKGAEVEHTVRAVPWAA 46 G + ++ E Q+ WWLAG + T RA+PW A Sbjct: 12 GALATIAFRECLRQLQWWLAGADQGLVATARALPWWA 48
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 31.6 bits (70), Expect = 0.62 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +1 Query: 91 LSGEP-PSYLTGEFPGDYGWDTAG 159 + G+P PSYL G PGD+G+D+ G Sbjct: 50 MPGQPRPSYLDGSAPGDFGFDSLG 73
>LTBP4_MOUSE (Q8K4G1) Latent transforming growth factor beta-binding protein 4| precursor (LTBP-4) Length = 1666 Score = 31.2 bits (69), Expect = 0.81 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 101 SPERGPR*STRSEPYHGLPDETCLAFDGC 15 S ERG SEPY GL E C DGC Sbjct: 1557 SSERGSYTGALSEPYEGLEAEECGILDGC 1585
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +1 Query: 103 PPSYLTGEFPGDYGWDTAG 159 PP YLTGE GD G+D AG Sbjct: 380 PPRYLTGEAYGDKGFDPAG 398 Score = 30.4 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 94 SGEPPSYLTGEFPGDYGWD 150 + EPP+ LTGE+P D G+D Sbjct: 193 NAEPPALLTGEYPADRGFD 211 Score = 27.7 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 106 PSYLTGEFPGDYGWDTAG 159 PS+L GE+ GD G+D AG Sbjct: 12 PSWLNGEYYGDRGFDPAG 29
>GLNA_HEBCY (Q96UV5) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) (GS) Length = 354 Score = 30.0 bits (66), Expect = 1.8 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 4 HAARQPSKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYG 144 HAA+ +AK+ PW+G ++ L G P + G FPG G Sbjct: 111 HAAKVMEQAKE---DVPWFGLEQEYTLFDADGSPYGWPKGGFPGPQG 154
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 30.0 bits (66), Expect = 1.8 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +1 Query: 19 PSKAKQVSSGSP-WYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 P KAK V S P W+ + P YL G GDYG+D G Sbjct: 42 PKKAKTVISDRPLWFPG----------AKSPEYLDGSLVGDYGFDPFG 79
>LH15_EUGGR (P08975) Light-harvesting complex I LH35 proteins precursor| [Contains: LH35 protein 1; LH35 protein 2] (Fragment) Length = 331 Score = 30.0 bits (66), Expect = 1.8 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +1 Query: 100 EPPSYLTGEFPGDYGWD 150 +PP++LTGE+P D G+D Sbjct: 167 QPPAHLTGEYPADRGFD 183
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 103 PPSYLTGEFPGDYGWDTAG 159 PP +L G PGD+G+D G Sbjct: 74 PPEWLDGSLPGDFGFDPLG 92
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 28.9 bits (63), Expect = 4.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 103 PPSYLTGEFPGDYGWDTAG 159 PP +L G PGD+G+D G Sbjct: 74 PPPWLDGSLPGDFGFDPLG 92
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 28.9 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 61 GSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAG 159 G++R L+ S + SYL G PGD+G+D G Sbjct: 50 GANRQLWFA--SKQSLSYLDGRLPGDFGFDPLG 80
>LIPB_GEOSL (Q74AE2) Lipoyltransferase (EC 2.3.1.-) (Lipoyl-[acyl-carrier| protein]-protein-N-lipoyltransferase) (Lipoate-protein ligase B) Length = 227 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 53 HGTALTVCSTSAPFPASHQAT*LVSSPVTT 142 HG AL +C+ APF H +V PVTT Sbjct: 137 HGFALNICNDLAPFSRIHPCG-IVGCPVTT 165
>GLNA_RAT (P09606) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) (GS) Length = 372 Score = 28.1 bits (61), Expect = 6.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 37 VSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYG 144 VSS PW+G ++ L G P + + FPG G Sbjct: 123 VSSQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQG 158
>CB4A_LYCES (P27524) Chlorophyll a-b binding protein CP24 10A, chloroplast| precursor (CAB-10A) (LHCP) Length = 256 Score = 28.1 bits (61), Expect = 6.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 106 PSYLTGEFPGDYGWDTAG 159 P +L G PGDYG+D G Sbjct: 68 PEWLDGSLPGDYGFDPLG 85
>PKDRE_HUMAN (Q9NTG1) Polycystic kidney disease and receptor for egg| jelly-related protein precursor (PKD and REJ homolog) Length = 2253 Score = 27.7 bits (60), Expect = 9.0 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 4 HAARQPSKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYL-TGEFPGDYG 144 H+ + S K+ + G+ +LYLGP S PPS+L G YG Sbjct: 604 HSVGEISSVKENTLGT-------ILYLGPQSTVPPSFLPVGMLASQYG 644
>ERYA1_SACER (Q03131) Erythronolide synthase, modules 1 and 2 (EC 2.3.1.94) (ORF| 1) (6-deoxyerythronolide B synthase I) (DEBS 1) Length = 3491 Score = 27.7 bits (60), Expect = 9.0 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -3 Query: 159 PGGVPSVVTGE--LTSQVAWWLAGKGAE 82 PGG V G L ++VA WLAG+GAE Sbjct: 3055 PGGTILVTGGTAGLGAEVARWLAGRGAE 3082
>GLNA_TUBBO (Q86ZU6) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) (GS) Length = 358 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 52 PWYGSDRVLYLGPLSGEPPSYLTGEFPGDYG 144 PW+G ++ L L G P + G FPG G Sbjct: 128 PWFGLEQEYTLFDLYGNPYGWPKGGFPGPQG 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.135 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,224,152 Number of Sequences: 219361 Number of extensions: 431118 Number of successful extensions: 1032 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 1011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)