| Clone Name | baet57d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUP88_HUMAN (Q99567) Nuclear pore complex protein Nup88 (Nucleop... | 29 | 3.2 | 2 | NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleop... | 29 | 3.2 | 3 | NUP88_RAT (O08658) Nuclear pore complex protein Nup88 (Nucleopor... | 29 | 3.2 |
|---|
>NUP88_HUMAN (Q99567) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 741 Score = 29.3 bits (64), Expect = 3.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 126 MASPSLPCRQRLGKRGTWSLPPLLSMEVLCM 34 + + LPCRQ RG W +P +L ++C+ Sbjct: 453 LCTKPLPCRQPAPIRGFWIVPDILGPTMICI 483
>NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 753 Score = 29.3 bits (64), Expect = 3.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 126 MASPSLPCRQRLGKRGTWSLPPLLSMEVLCM 34 + + LPCRQ RG W +P +L ++C+ Sbjct: 454 LCTKPLPCRQPAPIRGFWIVPDILGPTMICI 484
>NUP88_RAT (O08658) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) (Nucleoporin Nup84) Length = 742 Score = 29.3 bits (64), Expect = 3.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 126 MASPSLPCRQRLGKRGTWSLPPLLSMEVLCM 34 + + LPCRQ RG W +P +L ++C+ Sbjct: 454 LCTKPLPCRQPAPIRGFWIVPDILGPTMICI 484 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,575,663 Number of Sequences: 219361 Number of extensions: 254443 Number of successful extensions: 933 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 80,573,946 effective HSP length: 17 effective length of database: 76,844,809 effective search space used: 1844275416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)