| Clone Name | baet57c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RHBD3_HUMAN (Q9Y3P4) Rhomboid domain-containing protein 3 | 32 | 0.49 | 2 | NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 pr... | 30 | 2.4 | 3 | TNAP3_MOUSE (Q60769) Tumor necrosis factor, alpha-induced protei... | 29 | 4.2 | 4 | PDXH2_RALSO (Q8XS03) Pyridoxamine 5'-phosphate oxidase 2 (EC 1.4... | 28 | 9.3 |
|---|
>RHBD3_HUMAN (Q9Y3P4) Rhomboid domain-containing protein 3| Length = 386 Score = 32.0 bits (71), Expect = 0.49 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 2 AYWTQTQFPSSILRPSEPTF-GSTHAWLAWGRGAFDP 109 ++W + P LRP +PT+ GS+ A L W +F P Sbjct: 248 SHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSP 284
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch| 4) (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 29.6 bits (65), Expect = 2.4 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -1 Query: 121 QEASRIESTTPPCEP--CVRAPKSRLTRSENAGWKLCLCPVG 2 QE R E PC P C +L +++ + LCLCP G Sbjct: 226 QEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPG 267
>TNAP3_MOUSE (Q60769) Tumor necrosis factor, alpha-induced protein 3 (EC| 3.-.-.-) (Putative DNA binding protein A20) (Zinc finger protein A20) Length = 775 Score = 28.9 bits (63), Expect = 4.2 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -2 Query: 123 AKRRAGSKAPRPHASHACVLPKVGSLGLRMLDGNC 19 A +AGS APR + C+ + G+LG M +G C Sbjct: 625 ASAKAGSPAPRFQNNVPCLGRECGTLGSTMFEGYC 659
>PDXH2_RALSO (Q8XS03) Pyridoxamine 5'-phosphate oxidase 2 (EC 1.4.3.5) (PNP/PMP| oxidase 2) (PNPOx 2) Length = 213 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 19 TVSIQHSQTE*AYFWEHARMARMGAWCFRSCSPL 120 TV+ ++ AYF AR +R+GAW + PL Sbjct: 110 TVNRVSAEEADAYFVSRARASRIGAWASKQSRPL 143 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,251,447 Number of Sequences: 219361 Number of extensions: 274913 Number of successful extensions: 1050 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1050 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)