| Clone Name | baet57c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RK1_PEA (P49208) 50S ribosomal protein L1, chloroplast precursor... | 39 | 0.004 | 2 | VL1_HPV11 (P04012) Major capsid protein L1 | 29 | 4.1 | 3 | EAD_EBV (P03191) Early antigen protein D (EA-D) | 28 | 9.1 |
|---|
>RK1_PEA (P49208) 50S ribosomal protein L1, chloroplast precursor (Fragment)| Length = 208 Score = 38.9 bits (89), Expect = 0.004 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = +2 Query: 41 APTRPRTGKAALPLKRDRTRSKRYLEIQKLRE 136 +P R GK LK DR RSKR+LEIQKLRE Sbjct: 37 SPLSLRQGKLHWRLKSDRVRSKRFLEIQKLRE 68
>VL1_HPV11 (P04012) Major capsid protein L1| Length = 501 Score = 28.9 bits (63), Expect = 4.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 5 EDGYGGRGPAFTAPTRPRTGKAALPLKRDRTRSKR 109 + GY GR A T RP K + KR RT++K+ Sbjct: 467 QSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKK 501
>EAD_EBV (P03191) Early antigen protein D (EA-D)| Length = 404 Score = 27.7 bits (60), Expect = 9.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 23 RGPAFTAPTRPRTGKAALPLKRDRTRSKRYLEIQKLRE 136 R P + +P RP T A+P T +R L +Q R+ Sbjct: 343 RTPTWESPARPETPSPAIPSHSSNTALERPLAVQLARK 380 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,147,605 Number of Sequences: 219361 Number of extensions: 149307 Number of successful extensions: 520 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)