| Clone Name | baet57b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PANB_MYCLE (Q9CBT0) 3-methyl-2-oxobutanoate hydroxymethyltransfe... | 28 | 7.0 | 2 | POLG_LMV0 (P31999) Genome polyprotein [Contains: P1 proteinase (... | 28 | 7.0 | 3 | 2ACC_HUMAN (Q9Y5P8) Serine/threonine-protein phosphatase 2A 48 k... | 28 | 7.0 | 4 | VATL_ENTHI (Q24810) Vacuolar ATP synthase 16 kDa proteolipid sub... | 28 | 7.0 |
|---|
>PANB_MYCLE (Q9CBT0) 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC| 2.1.2.11) (Ketopantoate hydroxymethyltransferase) Length = 286 Score = 28.1 bits (61), Expect = 7.0 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -3 Query: 105 TIGVGEGLVCSACGLVWSGPAFGFAGEGDGRVWR 4 TIG+G GL C A LVW AG G+V R Sbjct: 222 TIGIGAGLNCDAQVLVWQ----DMAGLSSGKVAR 251
>POLG_LMV0 (P31999) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral gen Length = 3255 Score = 28.1 bits (61), Expect = 7.0 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 130 RLVPAASEHDRSRRRACLQRVRSGLVRSGLRFCRRGGW 17 RLV + H+ RR R+ +GL +R RGGW Sbjct: 337 RLVKLKTAHEEGHRRRVDIRIPNGLRPIVMRISARGGW 374
>2ACC_HUMAN (Q9Y5P8) Serine/threonine-protein phosphatase 2A 48 kDa| regulatory subunit B (PP2A, subunit B, PR48 isoform) Length = 414 Score = 28.1 bits (61), Expect = 7.0 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = -3 Query: 87 GLVCSACG--LVWSGPAF-GFAGEGDGRV 10 GLV ACG L W GP F G GE G V Sbjct: 5 GLVAKACGCPLYWKGPLFYGAGGERTGSV 33
>VATL_ENTHI (Q24810) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit) Length = 177 Score = 28.1 bits (61), Expect = 7.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 123 YRRRASTIGVGEGLVCSACGLVWSGPAFGFAGE 25 Y + + +G GL C CGL SG A G +G+ Sbjct: 92 YSLNRAFLDLGAGLTCGLCGLA-SGMAIGISGD 123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,353,055 Number of Sequences: 219361 Number of extensions: 303847 Number of successful extensions: 1260 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1260 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)