| Clone Name | baet56h05 |
|---|---|
| Clone Library Name | barley_pub |
>7SB1_SOYBN (P13917) Basic 7S globulin precursor (Bg) (SBg7S) [Contains: Basic| 7S globulin high-kDa subunit; Basic 7S globulin low-kDa subunit] Length = 427 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +3 Query: 147 STGQYLTGFRQRTPQVPVTAVLDLGGASLWVDCDAGYVSSSYAGVPC 287 STG + ++RTP + V ++DL G LWV+C+ Y S +Y C Sbjct: 43 STGLHWANLQKRTPLMQVPVLVDLNGNHLWVNCEQQYSSKTYQAPFC 89
>7SBG2_SOYBN (Q8RVH5) Basic 7S globulin 2 precursor (Bg) (SBg7S) [Contains:| Basic 7S globulin 2 high-kDa subunit; Basic 7S globulin 2 low-kDa subunit] Length = 433 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +3 Query: 147 STGQYLTGFRQRTPQVPVTAVLDLGGASLWVDCDAGYVSSSYAGVPC 287 STG + ++RTP + V ++DL G LWV+C+ Y S +Y C Sbjct: 50 STGLHWANLQKRTPLMQVPVLVDLNGNHLWVNCEQHYSSKTYQAPFC 96
>NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor (EC 3.4.23.-)| (Nepenthesin-I) Length = 437 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 13/59 (22%) Frame = +3 Query: 153 GQYLTGFRQRTPQVPVTAVLDLGGASLWVDCDA-------------GYVSSSYAGVPCA 290 G+YL TP P +A++D G +W C SSS++ +PC+ Sbjct: 93 GEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQCFNQSTPIFNPQGSSSFSTLPCS 151
>CARPV_CANAL (P10977) Vacuolar aspartic protease precursor (EC 3.4.23.-)| (Aspartate protease) (ACP) Length = 419 Score = 29.3 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +3 Query: 156 QYLTGFRQRTPQVPVTAVLDLGGASLWV---DC 245 QY T + TP P +LD G ++LWV DC Sbjct: 103 QYFTEIQIGTPGQPFKVILDTGSSNLWVPSQDC 135
>COA2_HUMAN (O00763) Acetyl-CoA carboxylase 2 (EC 6.4.1.2) (ACC-beta)| [Includes: Biotin carboxylase (EC 6.3.4.14)] Length = 2483 Score = 28.1 bits (61), Expect = 6.0 Identities = 20/57 (35%), Positives = 22/57 (38%) Frame = -3 Query: 290 GARHARVGRGHVPGVAVHPERGASKVEHGRHRDLGRSLPEARQVLPR*TCPSSPAAP 120 G R G GH P R + R SLP +RQ PR SS AAP Sbjct: 55 GETPQRNGEGHTLHKDTQPGRAQPPTKAQRSGRRRNSLPPSRQKPPRNPLSSSDAAP 111
>MSI2H_HUMAN (Q96DH6) RNA-binding protein Musashi homolog 2 (Musashi-2)| Length = 328 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 113 SAVVLPVRKDMFNGAVPDGLPAANAPGP 196 +A V R N A P G P AN+PGP Sbjct: 254 AAAVAAARGSGSNPARPGGFPGANSPGP 281
>NFKB1_HUMAN (P19838) Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor| KBF1) (EBP-1) [Contains: Nuclear factor NF-kappa-B p50 subunit] Length = 968 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 266 RGHVPGVAVHPERGASKVEHGRHRDLG 186 RG+ PG+ VHP+ + E G R LG Sbjct: 163 RGYNPGLLVHPDLAYLQAEGGGDRQLG 189
>NEP2_NEPGR (Q766C2) Aspartic proteinase nepenthesin-2 precursor (EC 3.4.23.-)| (Nepenthesin-II) Length = 438 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 153 GQYLTGFRQRTPQVPVTAVLDLGGASLWVDCD 248 G+YL TP +A++D G +W C+ Sbjct: 94 GEYLMNVAIGTPDSSFSAIMDTGSDLIWTQCE 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.127 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,574,532 Number of Sequences: 219361 Number of extensions: 511206 Number of successful extensions: 1490 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1490 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)