| Clone Name | baet56c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NDOB_PSEU8 (P0A111) Naphthalene 1,2-dioxygenase alpha subunit (E... | 28 | 5.3 | 2 | NDOB_PSEPU (P0A110) Naphthalene 1,2-dioxygenase alpha subunit (E... | 28 | 5.3 | 3 | SSRP_COREF (Q8FRE7) SsrA-binding protein | 28 | 6.9 |
|---|
>NDOB_PSEU8 (P0A111) Naphthalene 1,2-dioxygenase alpha subunit (EC 1.14.12.12)| (Naphthalene 1,2-dioxygenase ISP alpha) Length = 449 Score = 28.5 bits (62), Expect = 5.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 143 FFRSYDLHFSSSIQTEFKHRITNITSQLQSKTGR 42 F+R+Y H SSS EF+H + ++L T R Sbjct: 416 FYRAYQAHVSSSNWAEFEHASSTWHTELTKTTDR 449
>NDOB_PSEPU (P0A110) Naphthalene 1,2-dioxygenase alpha subunit (EC 1.14.12.12)| (Naphthalene 1,2-dioxygenase ISP alpha) Length = 449 Score = 28.5 bits (62), Expect = 5.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 143 FFRSYDLHFSSSIQTEFKHRITNITSQLQSKTGR 42 F+R+Y H SSS EF+H + ++L T R Sbjct: 416 FYRAYQAHVSSSNWAEFEHASSTWHTELTKTTDR 449
>SSRP_COREF (Q8FRE7) SsrA-binding protein| Length = 164 Score = 28.1 bits (61), Expect = 6.9 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -1 Query: 121 IFLHRFK-PSSNIGSPTSHPNYSPRQEEGLLHHRRQTDRL 5 ++LH P+ ++GS T+H SP++ LL HRR+ D L Sbjct: 64 VWLHNLHIPTYSMGSWTNH---SPKRTRKLLLHRREIDSL 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,692,462 Number of Sequences: 219361 Number of extensions: 323791 Number of successful extensions: 860 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)