| Clone Name | baet52h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DNJ15_ARATH (Q9ZSY2) Chaperone protein dnaJ 15 (Protein ALTERED ... | 28 | 6.0 | 2 | GLUD1_MOUSE (Q8CIX8) Glutamate--ammonia ligase domain-containing... | 28 | 7.9 | 3 | GLUD1_RAT (Q7TT51) Glutamate--ammonia ligase domain-containing p... | 28 | 7.9 |
|---|
>DNJ15_ARATH (Q9ZSY2) Chaperone protein dnaJ 15 (Protein ALTERED RESPONSE TO| GRAVITY) (AtARG1) (AtJ15) (AtDjB15) Length = 410 Score = 28.1 bits (61), Expect = 6.0 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 162 DNLAN*NILVARGKESKSDSRSSGERNGSSLNRE 263 +NL+N + A+G ESK D S+GE G+ NR+ Sbjct: 359 NNLSNGSSSKAQGDESKGDGDSAGEEGGTE-NRD 391
>GLUD1_MOUSE (Q8CIX8) Glutamate--ammonia ligase domain-containing protein 1| (Lengsin) (Lens glutamine synthase-like) Length = 563 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 101 DLCLFSTPRSISSLATPFLVSGCLGIHRKPFL 6 D C+F P I+S F S L H +PF+ Sbjct: 263 DFCIFGVPEVINSKTISFPASTLLSNHDQPFM 294
>GLUD1_RAT (Q7TT51) Glutamate--ammonia ligase domain-containing protein 1| (Lengsin) (Lens glutamine synthase-like) Length = 561 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 101 DLCLFSTPRSISSLATPFLVSGCLGIHRKPFL 6 D C+F P I+S F S L H +PF+ Sbjct: 261 DFCIFGVPEVINSKTISFPASTLLSNHDQPFM 292 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,291,372 Number of Sequences: 219361 Number of extensions: 628095 Number of successful extensions: 1398 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1398 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)