| Clone Name | baet51h04 |
|---|---|
| Clone Library Name | barley_pub |
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 338 CCSLLGGLADLEAAVCLCT 394 CC LLGGL DL+AA+CLCT Sbjct: 291 CCPLLGGLVDLDAAICLCT 309
>HPSE_SOYBN (P24337) Hydrophobic seed protein (HPS) (Allergen Gly m 1)| Length = 80 Score = 38.5 bits (88), Expect = 0.004 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 332 DKCCSLLGGLADLEAAVCLC 391 D CC+L+GGL D+EA VCLC Sbjct: 26 DDCCALIGGLGDIEAIVCLC 45
>14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor| Length = 137 Score = 38.1 bits (87), Expect = 0.005 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 338 CCSLLGGLADLEAAVCLCT 394 CCSLL GL +LEAAVCLCT Sbjct: 84 CCSLLEGLVNLEAAVCLCT 102
>CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor (Root-specific| protein ZRP3) Length = 129 Score = 37.0 bits (84), Expect = 0.011 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +2 Query: 332 DKCCSLLGGLADLEAAVCLCT 394 ++CC LL GL DL+AA+CLCT Sbjct: 73 EQCCPLLEGLVDLDAALCLCT 93
>XYNB_PSEFL (P23030) Endo-1,4-beta-xylanase B precursor (EC 3.2.1.8) (Xylanase| B) (1,4-beta-D-xylan xylanohydrolase B) Length = 592 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 26 TTSASQLKQPGAMASRTFSAACLLALLVANTFLAGDAC 139 T SAS + PG RT + C+ L A F A AC Sbjct: 2 TISASDYRHPGNFLKRTTALLCVGTALTALAFNASAAC 39
>GIGAN_ORYSA (Q9AWL7) GIGANTEA protein| Length = 1160 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 150 WQLLQASPARNVLATSSASRQAAEKVLDAI 61 WQ L ASP + A S+++ Q KV+DA+ Sbjct: 908 WQKLIASPEMQMSAESTSAHQGWRKVVDAL 937
>SYI_GLUOX (Q5FRI6) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 960 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 111 ATSSASRQAAEKVLDAIAPGCLSWLALVVV 22 A S +R+AA VLDA+ +WLA V+V Sbjct: 783 APSDPTRRAARTVLDALHRALCTWLAPVLV 812 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,833,911 Number of Sequences: 219361 Number of extensions: 227195 Number of successful extensions: 865 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)