| Clone Name | baet51h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYI_EHRCJ (Q3YRX3) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 5.0 | 2 | EFG_STAS1 (Q49V57) Elongation factor G (EF-G) | 28 | 8.6 |
|---|
>SYI_EHRCJ (Q3YRX3) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1120 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 72 P*AGKRQPGELTRMFSLIKNESWG-LEDDQI 161 P GKR P ++ R+ L+KN+ W LE+D++ Sbjct: 946 PELGKRIPDKVKRLIFLLKNDQWKILENDKL 976
>EFG_STAS1 (Q49V57) Elongation factor G (EF-G)| Length = 696 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +2 Query: 68 ESMSRQETTWRTDKDVFINQERKLGARRRSDTVLISTIND 187 E++ RQ TT+ + VF+N+ KLGA +STI+D Sbjct: 117 ETVWRQATTYGVPRIVFVNKMDKLGANFEYS---VSTIHD 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,067,511 Number of Sequences: 219361 Number of extensions: 439788 Number of successful extensions: 960 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)