| Clone Name | baet51b01 |
|---|---|
| Clone Library Name | barley_pub |
>NFIA_RAT (P09414) Nuclear factor 1 A-type (Nuclear factor 1/A) (NF1-A)| (NFI-A) (NF-I/A) (CCAAT-box-binding transcription factor) (CTF) (TGGCA-binding protein) Length = 509 Score = 30.4 bits (67), Expect = 2.3 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -3 Query: 435 KSTRSGN*SMKPSSIGALMAKSLKSTAHDRELLSQIRCRP-ATEPKVGFPAADVMARPGP 259 KS +SG S PS +L T H R +++ R P AT + FP + ++ +PGP Sbjct: 325 KSEKSGFSSPSPSQTSSL---GTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQPGP 381
>NFIA_HUMAN (Q12857) Nuclear factor 1 A-type (Nuclear factor 1/A) (NF1-A)| (NFI-A) (NF-I/A) (CCAAT-box-binding transcription factor) (CTF) (TGGCA-binding protein) Length = 509 Score = 30.4 bits (67), Expect = 2.3 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -3 Query: 435 KSTRSGN*SMKPSSIGALMAKSLKSTAHDRELLSQIRCRP-ATEPKVGFPAADVMARPGP 259 KS +SG S PS +L T H R +++ R P AT + FP + ++ +PGP Sbjct: 325 KSEKSGFSSPSPSQTSSL---GTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQPGP 381
>CH60_THET8 (Q5SLM2) 60 kDa chaperonin (Protein Cpn60) (groEL protein) (Heat| shock protein 60) Length = 542 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = -3 Query: 375 KSLKSTAHDRELLSQIRCRPATEPKVGFPAADVMARPGPGDVFRVTRNSALE 220 K+L DR+ + ++ A +P+VG AD M + G + V + +LE Sbjct: 130 KALAIPVEDRKAIEEVATISANDPEVGKLIADAMEKVGKEGIITVEESKSLE 181
>CH60_THET2 (P61490) 60 kDa chaperonin (Protein Cpn60) (groEL protein) (Heat| shock protein 60) Length = 542 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = -3 Query: 375 KSLKSTAHDRELLSQIRCRPATEPKVGFPAADVMARPGPGDVFRVTRNSALE 220 K+L DR+ + ++ A +P+VG AD M + G + V + +LE Sbjct: 130 KALAIPVEDRKAIEEVATISANDPEVGKLIADAMEKVGKEGIITVEESKSLE 181
>NFIA_MOUSE (Q02780) Nuclear factor 1 A-type (Nuclear factor 1/A) (NF1-A)| (NFI-A) (NF-I/A) (CCAAT-box-binding transcription factor) (CTF) (TGGCA-binding protein) Length = 532 Score = 30.4 bits (67), Expect = 2.3 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -3 Query: 435 KSTRSGN*SMKPSSIGALMAKSLKSTAHDRELLSQIRCRP-ATEPKVGFPAADVMARPGP 259 KS +SG S PS +L T H R +++ R P AT + FP + ++ +PGP Sbjct: 348 KSEKSGFSSPSPSQTSSL---GTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQPGP 404
>NFIA_CHICK (P17923) Nuclear factor 1 A-type (Nuclear factor 1/A) (NF1-A)| (NFI-A) (NF-I/A) (CCAAT-box-binding transcription factor) (CTF) (TGGCA-binding protein) Length = 522 Score = 30.4 bits (67), Expect = 2.3 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = -3 Query: 435 KSTRSGN*SMKPSSIGALMAKSLKSTAHDRELLSQIRCRP-ATEPKVGFPAADVMARPGP 259 KS +SG S PS +L T H R +++ R P AT + FP + ++ +PGP Sbjct: 338 KSEKSGFSSPSPSQTSSL---GTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQPGP 394
>MAT1_COCKU (Q9Y8D3) Mating-type protein MAT-1| Length = 379 Score = 29.3 bits (64), Expect = 5.2 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = +1 Query: 109 SRPEPSRKISEPFVSYSPQPQHFPN---EGLYKAYLVIQRFKSRISSDPKNITRTWSGHD 279 S P +R + +P+ +++P P H PN +GL +L Q ++++ + T + S Sbjct: 276 SPPPMNRYMPDPYSTFAPTPNHSPNPFYDGL-TGFLSEQASIEQVNAATLHNTHSLSDSG 334 Query: 280 ICGRKSYL 303 + G SY+ Sbjct: 335 LSGDMSYM 342
>DNAJ_THEMA (Q9WZV3) Chaperone protein dnaJ| Length = 369 Score = 28.9 bits (63), Expect = 6.8 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 8/54 (14%) Frame = +1 Query: 289 RKSYLGF--------RCGTTPDLAKKLTIMGG*FQ*FCHECADAGRLHRSVPRS 426 R+S+ G+ RCG T + ++ +CHEC +GR+ R V R+ Sbjct: 186 RRSFFGYFVSERTCERCGGTGKIPRE----------YCHECGGSGRVLRKVRRT 229 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,731,826 Number of Sequences: 219361 Number of extensions: 1490156 Number of successful extensions: 4522 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4520 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)