| Clone Name | baet50g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRGR_MOUSE (Q00175) Progesterone receptor (PR) | 29 | 3.0 | 2 | XYNB_PSEFL (P23030) Endo-1,4-beta-xylanase B precursor (EC 3.2.1... | 28 | 5.1 | 3 | GIGAN_ORYSA (Q9AWL7) GIGANTEA protein | 28 | 6.6 | 4 | SYI_GLUOX (Q5FRI6) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 8.7 |
|---|
>PRGR_MOUSE (Q00175) Progesterone receptor (PR)| Length = 923 Score = 29.3 bits (64), Expect = 3.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 Query: 71 PGPSRRPACWRCWWPTRSLPAMPATAAS 154 P P + PA C P SLPA P TAA+ Sbjct: 471 PLPCKPPAAASCLLPRDSLPAAPGTAAA 498
>XYNB_PSEFL (P23030) Endo-1,4-beta-xylanase B precursor (EC 3.2.1.8) (Xylanase| B) (1,4-beta-D-xylan xylanohydrolase B) Length = 592 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 28 TTSASQLKQPGAMASRTFSAACLLALLVANTFLAGDAC 141 T SAS + PG RT + C+ L A F A AC Sbjct: 2 TISASDYRHPGNFLKRTTALLCVGTALTALAFNASAAC 39
>GIGAN_ORYSA (Q9AWL7) GIGANTEA protein| Length = 1160 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 152 WQLLQASPARNVLATSSASRQAAEKVLDAI 63 WQ L ASP + A S+++ Q KV+DA+ Sbjct: 908 WQKLIASPEMQMSAESTSAHQGWRKVVDAL 937
>SYI_GLUOX (Q5FRI6) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 960 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 113 ATSSASRQAAEKVLDAIAPGCLSWLALVVV 24 A S +R+AA VLDA+ +WLA V+V Sbjct: 783 APSDPTRRAARTVLDALHRALCTWLAPVLV 812 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,369,793 Number of Sequences: 219361 Number of extensions: 290061 Number of successful extensions: 1716 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1714 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)