| Clone Name | baet50f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ERYA1_SACER (Q03131) Erythronolide synthase, modules 1 and 2 (EC... | 32 | 0.63 | 2 | THIG_NOCFA (Q5YNQ2) Thiazole biosynthesis protein thiG | 29 | 4.1 | 3 | JIP1_RAT (Q9R237) C-jun-amino-terminal kinase-interacting protei... | 28 | 6.9 | 4 | JIP1_MOUSE (Q9WVI9) C-jun-amino-terminal kinase-interacting prot... | 28 | 6.9 |
|---|
>ERYA1_SACER (Q03131) Erythronolide synthase, modules 1 and 2 (EC 2.3.1.94) (ORF| 1) (6-deoxyerythronolide B synthase I) (DEBS 1) Length = 3491 Score = 31.6 bits (70), Expect = 0.63 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 120 WTSAINDAAAGSPSDNALRRGHHIAQRPRPATCGSRHR 7 WT+A +D + RR RP PA+ G+RHR Sbjct: 375 WTAAYDDVGPNPALCRSSRRPRRKTSRPSPASTGTRHR 412
>THIG_NOCFA (Q5YNQ2) Thiazole biosynthesis protein thiG| Length = 256 Score = 28.9 bits (63), Expect = 4.1 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 21 RRSPDAAAALCDG-RAGERCRSASRLPHR*WLRSTA 125 +R P AAA+ D RAG R A R+P R W ++++ Sbjct: 218 KRPPLMAAAMADAVRAGLLAREAGRIPKRFWAQASS 253
>JIP1_RAT (Q9R237) C-jun-amino-terminal kinase-interacting protein 1| (JNK-interacting protein 1) (JIP-1) (JNK MAP kinase scaffold protein 1) (Islet-brain-1) (IB-1) (Mitogen-activated protein kinase 8-interacting protein 1) (JIP-1-related protein) (JRP) Length = 708 Score = 28.1 bits (61), Expect = 6.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 105 NDAAAGSPSDNALRRGHHIAQRPRPATC 22 N A+A SP ++A+ + A +PRP TC Sbjct: 412 NCASASSPYESAIGEEYEEAPQPRPPTC 439
>JIP1_MOUSE (Q9WVI9) C-jun-amino-terminal kinase-interacting protein 1| (JNK-interacting protein 1) (JIP-1) (JNK MAP kinase scaffold protein 1) (Islet-brain-1) (IB-1) (Mitogen-activated protein kinase 8-interacting protein 1) Length = 707 Score = 28.1 bits (61), Expect = 6.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 105 NDAAAGSPSDNALRRGHHIAQRPRPATC 22 N A+A SP ++A+ + A +PRP TC Sbjct: 411 NCASASSPYESAIGEEYEEAPQPRPPTC 438 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,410,398 Number of Sequences: 219361 Number of extensions: 329417 Number of successful extensions: 915 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 80,573,946 effective HSP length: 25 effective length of database: 75,089,921 effective search space used: 1802158104 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)