| Clone Name | baet50e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YU0O_CAEEL (Q19753) Hypothetical protein F23B12.7 in chromosome V | 28 | 5.7 | 2 | VG13_ICHV1 (Q00166) Hypothetical gene 13 zinc-binding protein | 28 | 7.5 |
|---|
>YU0O_CAEEL (Q19753) Hypothetical protein F23B12.7 in chromosome V| Length = 953 Score = 28.1 bits (61), Expect = 5.7 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 145 LGAPERAPWLRAVVGARGGRSMYQSMA---LLLQASSRCCSAL 26 LGA W+ +GARG ++ Y S+A L + AS S L Sbjct: 609 LGASSSGGWVHRSIGARGAKTPYDSVARNPLFVDASHTADSEL 651
>VG13_ICHV1 (Q00166) Hypothetical gene 13 zinc-binding protein| Length = 82 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 70 MALLLQASSRCCSALGLRCGGVC 2 MA LL CC+ + L CGG C Sbjct: 1 MAFLLPFLCNCCNPMSLLCGGGC 23 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,898,651 Number of Sequences: 219361 Number of extensions: 281952 Number of successful extensions: 1375 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1375 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)