| Clone Name | baet50e08 |
|---|---|
| Clone Library Name | barley_pub |
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 116 bits (290), Expect = 2e-26 Identities = 61/110 (55%), Positives = 74/110 (67%) Frame = +2 Query: 86 MAALAPTKMLGTRLDFAGSSRYATAAPTAGAQKIVSLFDRFNXXXXXXXXXXXVATSSAG 265 MA+L ++MLGT L+F SR ++AP A + F+ V+ +S Sbjct: 1 MASLGVSEMLGTPLNFRAVSR--SSAPLASSPSTFKTVALFSKKKPAPAKSKAVSETS-- 56 Query: 266 IDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 DELAKWYGPDRRI+LP+GLLDRSE+PEYLNGEV GDYGYDPFGLGKKP Sbjct: 57 --DELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKP 104
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 51.2 bits (121), Expect = 9e-07 Identities = 32/88 (36%), Positives = 38/88 (43%) Frame = +2 Query: 152 ATAAPTAGAQKIVSLFDRFNXXXXXXXXXXXVATSSAGIDDELAKWYGPDRRIYLPNGLL 331 A+ A TA + +V VA SA WYGPDR YL Sbjct: 2 ASMAATASSTTVVKATPFLGQTKNANPLRDVVAMGSARFTMSNDLWYGPDRVKYLGPF-- 59 Query: 332 DRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 ++ P YLNGE PGDYG+D GL P Sbjct: 60 -SAQTPSYLNGEFPGDYGWDTAGLSADP 86
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 49.7 bits (117), Expect = 3e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR +YL G L E P YL GE PGDYG+D GL P Sbjct: 49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADP 88
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 49.7 bits (117), Expect = 3e-06 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR +YL G L E P YL GE PGDYG+D GL P Sbjct: 49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADP 88
>CB2_DUNTE (P27517) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 48.5 bits (114), Expect = 6e-06 Identities = 22/44 (50%), Positives = 28/44 (63%) Frame = +2 Query: 284 KWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 ++YGPDR +L G ++ PEYL GE PGDYG+D GL P Sbjct: 32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWDTAGLSADP 73
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 48.5 bits (114), Expect = 6e-06 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL ++ P YLNGE PGDYG+D GL P Sbjct: 50 WYGPDRVKYLGPF---SAQTPSYLNGEFPGDYGWDTAGLSADP 89
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 48.5 bits (114), Expect = 6e-06 Identities = 26/53 (49%), Positives = 30/53 (56%) Frame = +2 Query: 257 SAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 +A ID + WYGPDR +YL E P YL GE PGDYG+D GL P Sbjct: 55 AASID---SPWYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADP 101
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 48.1 bits (113), Expect = 8e-06 Identities = 26/53 (49%), Positives = 30/53 (56%) Frame = +2 Query: 257 SAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 +A ID + WYGPDR +YL E P YL GE PGDYG+D GL P Sbjct: 55 AASID---SPWYGPDRVMYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADP 101
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 48.1 bits (113), Expect = 8e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR +YL E P YL GE PGDYG+D GL P Sbjct: 58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADP 97
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 47.4 bits (111), Expect = 1e-05 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL ++P YL GE PGDYG+D GL P Sbjct: 49 WYGPDRPKYLGPF---SEQIPSYLTGEFPGDYGWDTAGLSADP 88
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 47.4 bits (111), Expect = 1e-05 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL ++P YL GE PGDYG+D GL P Sbjct: 49 WYGPDRPKYLGPF---SDQIPSYLTGEFPGDYGWDTAGLSADP 88
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 47.4 bits (111), Expect = 1e-05 Identities = 26/55 (47%), Positives = 29/55 (52%) Frame = +2 Query: 251 TSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 T A + D + WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 38 TVKAPVSD--SPWYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADP 87
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 47.0 bits (110), Expect = 2e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADP 89
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 47.0 bits (110), Expect = 2e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADP 89
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 47.0 bits (110), Expect = 2e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 51 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADP 90
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 47.0 bits (110), Expect = 2e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 51 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADP 90
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 46.6 bits (109), Expect = 2e-05 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR +YL G L E P YL GE PGDYG+D GL P Sbjct: 50 WYGSDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADP 89
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 46.6 bits (109), Expect = 2e-05 Identities = 33/92 (35%), Positives = 39/92 (42%) Frame = +2 Query: 140 SSRYATAAPTAGAQKIVSLFDRFNXXXXXXXXXXXVATSSAGIDDELAKWYGPDRRIYLP 319 +S A ++P AG K V L + S A + WYGPDR YL Sbjct: 3 ASTTALSSPFAG--KAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLG 60 Query: 320 NGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 E P YL GE PGDYG+D GL P Sbjct: 61 PF---SGESPSYLTGEFPGDYGWDTAGLSADP 89
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 46.6 bits (109), Expect = 2e-05 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR +YL G L E P YL GE PGDYG+D GL P Sbjct: 45 WYGADRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADP 84
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 46.6 bits (109), Expect = 2e-05 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR +YL G L E P YL GE PGDYG+D GL P Sbjct: 49 WYGADRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADP 88
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 29 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADP 68
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 47 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADP 86
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 46.2 bits (108), Expect = 3e-05 Identities = 22/43 (51%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL + P YL GE PGDYG+D GL P Sbjct: 47 WYGPDRPKYLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADP 86
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 48 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 87
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 91
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 39 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADP 78
>CB21_SILPR (P12332) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 205 Score = 46.2 bits (108), Expect = 3e-05 Identities = 22/43 (51%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL + P YL GE PGDYG+D GL P Sbjct: 48 WYGPDRPKYLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADP 87
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 49 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 88
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 49 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 88
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 53 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 92
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 46 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADP 85
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 50 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 89
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 51 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 90
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 51 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 90
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 51 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 90
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 46.2 bits (108), Expect = 3e-05 Identities = 23/43 (53%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D GL P Sbjct: 51 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 90
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 45.4 bits (106), Expect = 5e-05 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR +YL G L S P YL GE PGDYG+D GL P Sbjct: 48 WYGADRVLYL--GPLSGSP-PSYLTGEFPGDYGWDTEGLSADP 87
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 45.4 bits (106), Expect = 5e-05 Identities = 25/53 (47%), Positives = 29/53 (54%) Frame = +2 Query: 257 SAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 SAGI+ WYGPDR +L + P YL GE PGDYG+D GL P Sbjct: 34 SAGIE-----WYGPDRAKWLGPF---STNTPAYLTGEFPGDYGWDTAGLSADP 78
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 45.1 bits (105), Expect = 7e-05 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR +YL G S P YL+GE PGDYG+D GL P Sbjct: 49 WYGSDRPLYL--GPFSGSP-PSYLSGEFPGDYGWDTAGLSADP 88
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 44.7 bits (104), Expect = 9e-05 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +2 Query: 296 PDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 PDR ++ P S PE+L+G +PGD+G+DP GLG P Sbjct: 63 PDRPLWFPG-----STPPEWLDGSLPGDFGFDPLGLGSDP 97
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 44.7 bits (104), Expect = 9e-05 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE P DYG+D GL P Sbjct: 51 WYGPDRVKYLGPF---SGEAPSYLTGEFPSDYGWDTAGLSADP 90
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 44.3 bits (103), Expect = 1e-04 Identities = 22/43 (51%), Positives = 24/43 (55%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGP+R YL E P YL GE PGDYG+D GL P Sbjct: 51 WYGPNRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 90
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 43.9 bits (102), Expect = 1e-04 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL E P YL GE PGDYG+D L P Sbjct: 51 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAELSADP 90
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 43.9 bits (102), Expect = 1e-04 Identities = 21/43 (48%), Positives = 28/43 (65%) Frame = +2 Query: 281 AKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGK 409 AK DR ++ P ++ PEYL+G + GDYG+DPFGLGK Sbjct: 45 AKTVISDRPLWFPG-----AKSPEYLDGSLVGDYGFDPFGLGK 82
>CB4A_LYCES (P27524) Chlorophyll a-b binding protein CP24 10A, chloroplast| precursor (CAB-10A) (LHCP) Length = 256 Score = 43.5 bits (101), Expect = 2e-04 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +2 Query: 347 PEYLNGEVPGDYGYDPFGLGKKP 415 PE+L+G +PGDYG+DP GLGK P Sbjct: 68 PEWLDGSLPGDYGFDPLGLGKDP 90
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 43.1 bits (100), Expect = 3e-04 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR YL E P YL GE PGDYG+D GL P Sbjct: 49 WYGSDRVKYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADP 88
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 43.1 bits (100), Expect = 3e-04 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR YL E P YL GE PGDYG+D GL P Sbjct: 50 WYGSDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 89
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 43.1 bits (100), Expect = 3e-04 Identities = 22/43 (51%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR YL E P YL GE PGDYG+D GL P Sbjct: 50 WYGSDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 89
>CB2_CHLRE (P14273) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 43.1 bits (100), Expect = 3e-04 Identities = 23/56 (41%), Positives = 31/56 (55%) Frame = +2 Query: 248 ATSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 A S+G++ +YGP+R +L G + P YL GE PGDYG+D GL P Sbjct: 28 APKSSGVE-----FYGPNRAKWL--GPYSENATPAYLTGEFPGDYGWDTAGLSADP 76
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 43.1 bits (100), Expect = 3e-04 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR YL + P YL GE PGDYG+D GL P Sbjct: 49 WYGEDRPKYLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADP 88
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 43.1 bits (100), Expect = 3e-04 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR YL + P YL GE PGDYG+D GL P Sbjct: 49 WYGEDRPKYLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADP 88
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 43.1 bits (100), Expect = 3e-04 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR YL + P YL GE PGDYG+D GL P Sbjct: 49 WYGEDRPKYLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADP 88
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 43.1 bits (100), Expect = 3e-04 Identities = 25/55 (45%), Positives = 28/55 (50%) Frame = +2 Query: 251 TSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 + SAG D WYG DR +L E P YLNGE GDYG+D GL P Sbjct: 43 SKSAGSD---TIWYGADRPKFLGPF---SGETPSYLNGEFAGDYGWDTAGLSSDP 91
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 43.1 bits (100), Expect = 3e-04 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR YL + P YL GE PGDYG+D GL P Sbjct: 21 WYGEDRPKYLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADP 60
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 42.0 bits (97), Expect = 6e-04 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYGPDR YL G P YL GE PGDYG+D + P Sbjct: 50 WYGPDRPKYL--GPFSEG-TPSYLTGEFPGDYGWDTAAVSADP 89
>CB4B_LYCES (P27525) Chlorophyll a-b binding protein CP24 10B, chloroplast| precursor (CAB-10B) (LHCP) Length = 256 Score = 42.0 bits (97), Expect = 6e-04 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 347 PEYLNGEVPGDYGYDPFGLGKKP 415 PE+L+G +PGD+G+DP GLGK P Sbjct: 68 PEWLDGSLPGDFGFDPLGLGKDP 90
>CB4_SPIOL (P36494) Chlorophyll a-b binding protein CP24, chloroplast| precursor Length = 261 Score = 42.0 bits (97), Expect = 6e-04 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 347 PEYLNGEVPGDYGYDPFGLGKKP 415 PE+L+G +PGD+G+DP GLGK P Sbjct: 73 PEWLDGSLPGDFGFDPLGLGKDP 95
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 41.6 bits (96), Expect = 7e-04 Identities = 20/43 (46%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 WYG DR +L + P YL GE PGDYG+D GL P Sbjct: 48 WYGADRPKFLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADP 87
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 41.6 bits (96), Expect = 7e-04 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 W+GPD YL E P YL GE PGDYG+D GL P Sbjct: 12 WHGPDGVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADP 51
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 296 PDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 PDR ++ P S P +L+G +PGD+G+DP GL P Sbjct: 63 PDRPLWFPG-----STPPPWLDGSLPGDFGFDPLGLASDP 97
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +2 Query: 299 DRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGK 409 DR ++ P + P++L+G + GDYG+DPFGLGK Sbjct: 54 DRPLWYPGAIS-----PDWLDGSLVGDYGFDPFGLGK 85
>CB4C_ARATH (Q9S7W1) Chlorophyll a-b binding protein CP29.3, chloroplast| precursor (LHCII protein 4.3) (LHCB4.3) Length = 276 Score = 37.7 bits (86), Expect = 0.011 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +2 Query: 299 DRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGK 409 DR ++ P + PE+L+G + GD G+DPFGLGK Sbjct: 55 DRLVWFPG-----ANPPEWLDGSMIGDRGFDPFGLGK 86
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 36.6 bits (83), Expect = 0.023 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 347 PEYLNGEVPGDYGYDPFGLGKKP 415 P YL+G PGD+G+D GLG+ P Sbjct: 56 PSYLDGSAPGDFGFDSLGLGEVP 78
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 36.6 bits (83), Expect = 0.023 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 341 EVPEYLNGEVPGDYGYDPFGLGKKP 415 E P YL GE PGDYG+D GL P Sbjct: 5 EPPSYLTGEFPGDYGWDTAGLSADP 29
>CB29_CHLRE (Q93WD2) Chlorophyll a-b binding protein CP29| Length = 279 Score = 36.2 bits (82), Expect = 0.031 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +2 Query: 308 IYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGK 409 ++LPN + PE+L+G +PGD G+DP GL K Sbjct: 51 LWLPN-----TTRPEWLDGSLPGDRGFDPLGLSK 79
>CB2_MALDO (P15773) Chlorophyll a-b binding protein AB10, chloroplast| precursor (LHCII type I CAB-AB10) (LHCP) Length = 268 Score = 35.8 bits (81), Expect = 0.040 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 341 EVPEYLNGEVPGDYGYDPFGLGKKP 415 E P YL GE PGDYG+D GL P Sbjct: 68 EWPSYLTGEFPGDYGWDTAGLSAYP 92
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 33.9 bits (76), Expect = 0.15 Identities = 22/71 (30%), Positives = 30/71 (42%) Frame = +2 Query: 203 RFNXXXXXXXXXXXVATSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDY 382 R N TSS ++ + +W LP GL P+YL G + GD Sbjct: 29 RLNRDLSFTSIGSSAKTSSFKVEAKKGEW--------LP-GLAS----PDYLTGSLAGDN 75 Query: 383 GYDPFGLGKKP 415 G+DP GL + P Sbjct: 76 GFDPLGLAEDP 86
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 33.1 bits (74), Expect = 0.26 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +2 Query: 299 DRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 +R ++ PN + P YL GE GD G+DP GL P Sbjct: 370 ERELWFPNIV-----PPRYLTGEAYGDKGFDPAGLAADP 403 Score = 33.1 bits (74), Expect = 0.26 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +2 Query: 308 IYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 ++ PN L P +LNGE GD G+DP GL P Sbjct: 4 LWFPNTL-----APSWLNGEYYGDRGFDPAGLAADP 34 Score = 30.0 bits (66), Expect = 2.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 308 IYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 ++ PN +E P L GE P D G+DP L P Sbjct: 189 LWFPN-----AEPPALLTGEYPADRGFDPLNLAADP 219
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 32.7 bits (73), Expect = 0.34 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +2 Query: 353 YLNGEVPGDYGYDPFGL 403 YL+G +PGD+G+DP GL Sbjct: 65 YLDGRLPGDFGFDPLGL 81
>CB2_DUNSA (P20865) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 273 Score = 32.3 bits (72), Expect = 0.44 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +2 Query: 284 KWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDPFGLGKKP 415 ++YGPD +G + + P GE PGDYG+D GL P Sbjct: 56 QFYGPDAT----SGWDLQHQHPRLPTGEFPGDYGWDTAGLSADP 95
>UBIE_PORGI (Q7MVR7) Menaquinone biosynthesis methyltransferase ubiE (EC| 2.1.1.-) Length = 245 Score = 30.0 bits (66), Expect = 2.2 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -1 Query: 388 VAVVSGNLAVEVLRHLRPVKEAVGQVDPPVRAVPLGE 278 VA +G+LA+E+ RH+ VK+ G VD + + +GE Sbjct: 65 VATGTGDLAIEICRHIPSVKQVTG-VDLSLEMMRIGE 100
>NLPD_SALTY (P40827) Lipoprotein nlpD precursor| Length = 377 Score = 30.0 bits (66), Expect = 2.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 276 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 365 N P+GT +T T PT S T STST+ Sbjct: 223 NKPAGTVVTAPVTAPTVSTTEPNASSTSTS 252
>NLPD_SALTI (Q56131) Lipoprotein nlpD precursor| Length = 373 Score = 30.0 bits (66), Expect = 2.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 276 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 365 N P+GT +T T PT S T STST+ Sbjct: 219 NKPAGTVVTAPVTAPTVSTTEPNASSTSTS 248
>NLPD_SALDU (P39700) Lipoprotein nlpD precursor| Length = 377 Score = 30.0 bits (66), Expect = 2.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 276 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 365 N P+GT +T T PT S T STST+ Sbjct: 223 NKPAGTVVTAPVTAPTVSTTEPNASSTSTS 252
>INLA_LISMF (Q723K6) Internalin A precursor| Length = 800 Score = 29.3 bits (64), Expect = 3.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 276 NSPSGTALTGGSTCPTASLTGRRCRSTSTARFPETTATI 392 N+P T G +T P+A++ G +TST TT+T+ Sbjct: 716 NTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTM 754
>PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EIICBA component| [Includes: Glucosamine permease IIC component (PTS system glucosamine-specific EIIC component); Glucosamine-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS Length = 631 Score = 28.9 bits (63), Expect = 4.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 186 IFCAPAVGAAVAYLEEPAKSSRVPSILVGAS 94 IFC PAV A+ + P K + +++ A+ Sbjct: 252 IFCLPAVALAIIHTARPEKKKMISGVMISAA 282
>LH15_EUGGR (P08975) Light-harvesting complex I LH35 proteins precursor| [Contains: LH35 protein 1; LH35 protein 2] (Fragment) Length = 331 Score = 28.5 bits (62), Expect = 6.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 338 SEVPEYLNGEVPGDYGYDPFGLGKKP 415 ++ P +L GE P D G+DP + P Sbjct: 166 AQPPAHLTGEYPADRGFDPLSVAADP 191
>INLA_LISMO (P25146) Internalin A precursor| Length = 800 Score = 28.5 bits (62), Expect = 6.4 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 276 NSPSGTALTGGSTCPTASLTGRRCRSTSTARFPETTATI 392 N+P T G +T P+A++ G +TST TT+T+ Sbjct: 716 NTPPTTNNGGNTTPPSANIPGSDTSNTSTGNSASTTSTM 754
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 28.5 bits (62), Expect = 6.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 287 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPG 376 WYGPDR YL E P YL GE G Sbjct: 48 WYGPDRVKYLGP---FSGEAPSYLTGEFHG 74
>NLPD_SHIFL (P0ADA4) Lipoprotein nlpD precursor| Length = 379 Score = 28.1 bits (61), Expect = 8.3 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 276 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 365 N P+ T +T T PTAS T STST+ Sbjct: 225 NKPTATTVTAPVTVPTASTTEPTVSSTSTS 254
>NLPD_ECOLI (P0ADA3) Lipoprotein nlpD precursor| Length = 379 Score = 28.1 bits (61), Expect = 8.3 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 276 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 365 N P+ T +T T PTAS T STST+ Sbjct: 225 NKPTATTVTAPVTVPTASTTEPTVSSTSTS 254
>C8AP2_HUMAN (Q9UKL3) CASP8-associated protein 2 (FLICE-associated huge protein)| Length = 1982 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 352 LRHLRPVKEAVGQVDPPVRAV 290 L HLRP+ EA+ ++ PVR V Sbjct: 847 LNHLRPIPEAISPLNSPVRPV 867
>ALB32_ARATH (Q8L718) Inner membrane ALBINO3-like protein 2, chloroplast| precursor (Ath5) Length = 525 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 1 THHILPSC*AEHAPLLHAPSPS 66 +HH+ PS H+P L +PSPS Sbjct: 23 SHHLKPSSFISHSPPLFSPSPS 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,929,096 Number of Sequences: 219361 Number of extensions: 741132 Number of successful extensions: 2637 Number of sequences better than 10.0: 83 Number of HSP's better than 10.0 without gapping: 2533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2596 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)