| Clone Name | baet50e02 |
|---|---|
| Clone Library Name | barley_pub |
>SYH_THEFY (Q47RX0) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 438 Score = 30.8 bits (68), Expect = 0.96 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = -1 Query: 249 LEKPPTDALRPIIPDNACILCLTAAAGTELADAYSSDTVIVSSPRK 112 L K DA+R I+ D A + AAA ELA+ SDT +V + K Sbjct: 200 LHKIGADAVREILIDQAGLSSDQAAACLELAEIRGSDTTVVDAVAK 245
>M470_ARATH (P93302) Hypothetical mitochondrial protein AtMg00470 (ORF122a)| Length = 122 Score = 28.1 bits (61), Expect = 6.2 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 5 RPRLLREAAVGNFPQWAKA*RSNA--AWRWKAYGSSTSFLGEETM 133 R RLL E AVGNFPQ K S + A R + S TS +E + Sbjct: 43 RLRLLLELAVGNFPQGFKIHLSGSFQAVRLALFSSFTSLRTDELL 87
>BCR_HUMAN (P11274) Breakpoint cluster region protein (EC 2.7.11.1) (NY-REN-26| antigen) Length = 1271 Score = 28.1 bits (61), Expect = 6.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 15 SYGRQQWGIFRNGRKPDGA 71 SY RQ+WG R + PDGA Sbjct: 69 SYDRQRWGFRRAAQAPDGA 87
>PPNK2_SYNP6 (Q5MZV1) Probable inorganic polyphosphate/ATP-NAD kinase 2 (EC| 2.7.1.23) (Poly(P)/ATP NAD kinase 2) Length = 306 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 225 LRPIIPDNACILCLTAAAGTELADAYSSDTVIVSSP 118 ++P PD + L E+ D Y D +IVS+P Sbjct: 153 VKPAAPDRMSVCILEMEVDGEIIDQYQGDGLIVSTP 188
>NCOR2_MOUSE (Q9WU42) Nuclear receptor corepressor 2 (N-CoR2) (Silencing mediator| of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated corepressor) (T3 receptor-associating factor) (TRAC) Length = 2472 Score = 27.7 bits (60), Expect = 8.2 Identities = 23/65 (35%), Positives = 29/65 (44%) Frame = -2 Query: 245 KSHLQTLYAQSFRITLASSVLPRLPAQS*PMLIPQIPSLFLLREKKLTTRRPSTSTRHCS 66 +S L YA R + S +P LP P P P+ + R L T P S+RH S Sbjct: 1688 ESSLALNYAAGPRGIIDLSQVPHLPVLVPPT--PGTPATAIDRLAYLPTAPPPFSSRHSS 1745 Query: 65 VRLSP 51 LSP Sbjct: 1746 SPLSP 1750
>POL_AVIRE (P03360) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] (Fragment) Length = 473 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 118 EKRS*RPVGLPPPRGIAPSGFRPLRK 41 E R R +GLPPP G AP P R+ Sbjct: 304 EDRDRRGLGLPPPSGFAPGTVYPGRE 329 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,097,719 Number of Sequences: 219361 Number of extensions: 713940 Number of successful extensions: 2208 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2206 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)