| Clone Name | baet50d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | INAA_ECOLI (P27294) Protein inaA | 30 | 2.3 | 2 | MURF_SYNY3 (P45450) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-... | 29 | 5.1 | 3 | LRC41_HUMAN (Q15345) Leucine-rich repeat-containing protein 41 (... | 29 | 6.7 |
|---|
>INAA_ECOLI (P27294) Protein inaA| Length = 216 Score = 30.4 bits (67), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 125 NHWWAIDGGWRQRPSTHGCGFVG 57 NHWWA +G W + P+ G G Sbjct: 11 NHWWATEGDWVEEPNYRRNGMSG 33
>MURF_SYNY3 (P45450) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase| (EC 6.3.2.10) (UDP-MurNAc-pentapeptide synthetase) (D-alanyl-D-alanine-adding enzyme) Length = 454 Score = 29.3 bits (64), Expect = 5.1 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 Query: 110 IDGGWRQRPSTHGCGFVGSGGDPTLTVLVAAVHTRF 3 I GWRQR + G GS G T L+AAV ++F Sbjct: 99 IAAGWRQRFTIPIIGVTGSVGKTTTKELIAAVLSQF 134
>LRC41_HUMAN (Q15345) Leucine-rich repeat-containing protein 41 (Protein Muf1)| Length = 843 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 118 GGRSMEGGAKGHQLMAVDSWAVEEIQHSPCLSLLSTHAL 2 G R+ + A+ HQL ++WA + H LSL T L Sbjct: 792 GARTSQSHARYHQLAGAEAWAAQNPNHQFYLSLSVTFFL 830 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,988,960 Number of Sequences: 219361 Number of extensions: 930508 Number of successful extensions: 2265 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2263 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)