ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet50b04 |
|---|---|
| Clone Library Name | barley_pub |
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 74.3 bits (181), Expect = 8e-14 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +1 Query: 34 HREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 H+EVY GALKAALAEFISTLIFVFAGQGSGMAFSKL+ G TP Sbjct: 11 HQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTP 55
>TIP12_ARATH (Q41963) Aquaporin TIP1.2 (Tonoplast intrinsic protein 1.2)| (Gamma-tonoplast intrinsic protein 2) (Gamma-TIP2) (Salt stress-induced tonoplast intrinsic protein) Length = 253 Score = 63.2 bits (152), Expect = 2e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 40 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 EVY AL+AALAEFISTLIFVFAG GSG+AF+K++ +G TP Sbjct: 14 EVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTP 56
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 59.7 bits (143), Expect = 2e-09 Identities = 32/48 (66%), Positives = 35/48 (72%) Frame = +1 Query: 25 IPRHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 I R E ALKAALAEFISTLIFV AG GSGMAF+KL+ +G TP Sbjct: 8 IGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTP 55
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 57.4 bits (137), Expect = 1e-08 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 37 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 +E LKA LAEFIST IFVFAG GSG+A++KL+ DG ATP Sbjct: 12 QEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATP 55
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 57.4 bits (137), Expect = 1e-08 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 37 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 +E LKA LAEFIST IFVFAG GSG+A++KL+ DG ATP Sbjct: 12 QEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATP 55
>TIP13_ARATH (O82598) Putative aquaporin TIP1.3 (Tonoplast intrinsic protein| 1.3) (Gamma-tonoplast intrinsic protein 3) (Gamma-TIP3) Length = 252 Score = 55.5 bits (132), Expect = 4e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 58 ALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 A++AA AEF S +IFVFAGQGSGMA+ KL+ DG ATP Sbjct: 19 AIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATP 55
>TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrinsic protein| 1.2) (OsTIP1.2) Length = 252 Score = 53.9 bits (128), Expect = 1e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 KAA+AEFIS LIFVFAG GSGMAFSKL+ G TP Sbjct: 21 KAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTP 55
>TIP23_ARATH (Q9FGL2) Probable aquaporin TIP2.3 (Tonoplast intrinsic protein| 2.3) Length = 250 Score = 52.0 bits (123), Expect = 4e-07 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 46 YEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 + V +LKA L+EFI+TL+FVFAG GS +AF+KL+ DG P Sbjct: 13 FSVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDP 53
>TIP2_TOBAC (P24422) Probable aquaporin TIP-type RB7-18C (Tonoplast intrinsic| protein, root-specific RB7-18C) (TobRB7) (RT-TIP) Length = 250 Score = 50.8 bits (120), Expect = 9e-07 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 46 YEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 + VG+LKA +AEFI+TL+FVFAG GS +A++KL+ D P Sbjct: 13 FSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDP 53
>TIP1_TOBAC (P21653) Probable aquaporin TIP-type RB7-5A (Tonoplast intrinsic| protein, root-specific RB7-5A) (TobRB7) (RT-TIP) Length = 250 Score = 50.8 bits (120), Expect = 9e-07 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 46 YEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 + VG+LKA +AEFI+TL+FVFAG GS +A++KL+ D P Sbjct: 13 FSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDP 53
>TIP22_ARATH (Q41975) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) Length = 250 Score = 50.1 bits (118), Expect = 2e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = +1 Query: 46 YEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 + V +LKA L+EFI+TL+FVFAG GS +AF+KL+ D P Sbjct: 13 FSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDP 53
>TIP_ANTMA (P33560) Probable aquaporin TIP-type (Tonoplast intrinsic protein| DiP) (Dark intrinsic protein) Length = 250 Score = 47.8 bits (112), Expect = 8e-06 Identities = 21/41 (51%), Positives = 31/41 (75%) Frame = +1 Query: 46 YEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 + V ++KA +AEFI+TL+FVFAG GS +A++KL+ D P Sbjct: 13 FSVASIKAYVAEFIATLLFVFAGVGSAIAYNKLTSDAALDP 53
>TIP21_ARATH (Q41951) Aquaporin TIP2.1 (Tonoplast intrinsic protein 2.1)| (Delta-tonoplast intrinsic protein) (Delta-TIP) Length = 250 Score = 46.6 bits (109), Expect = 2e-05 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = +1 Query: 46 YEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPD 153 + + +L+A LAEFISTL+FVFAG GS +A++KL+ D Sbjct: 13 FSLASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSD 48
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 45.4 bits (106), Expect = 4e-05 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +1 Query: 31 RHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLS 147 R + + +LKA +AEFISTL+FVFAG GS +A++KL+ Sbjct: 9 RFDDSFSAASLKAYVAEFISTLVFVFAGVGSAIAYTKLT 47
>TIP43_ORYSA (Q9LWR2) Probable aquaporin TIP4.3 (Tonoplast intrinsic protein| 4.3) (OsTIP4.3) Length = 251 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +1 Query: 34 HREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDG 156 HRE + G L+A +AE + T +FVF+G GS MA +KL G Sbjct: 9 HREATDPGCLRAVVAELLLTFLFVFSGVGSAMAAAKLGGGG 49
>TIPA_PHAVU (P23958) Probable aquaporin TIP-type alpha (Tonoplast intrinsic| protein alpha) (Alpha TIP) Length = 256 Score = 43.1 bits (100), Expect = 2e-04 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = +1 Query: 31 RHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPD 153 R E +++A+LAEF ST IFVFAG+GSG+A K+ D Sbjct: 10 RTDEATHPDSMRASLAEFASTFIFVFAGEGSGLALVKIYQD 50
>TIP21_ORYSA (Q7XA61) Probable aquaporin TIP2.1 (Tonoplast intrinsic protein| 2.1) (OsTIP2.1) Length = 248 Score = 42.4 bits (98), Expect = 3e-04 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +1 Query: 46 YEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 + ++KA +AEFI+TL+FVFAG GS +A+ +L+ G P Sbjct: 13 FSATSVKAYVAEFIATLLFVFAGVGSAIAYGQLTNGGALDP 53
>TIP32_ARATH (O22588) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (Beta-tonoplast intrinsic protein) (Beta-TIP) Length = 267 Score = 40.8 bits (94), Expect = 0.001 Identities = 21/44 (47%), Positives = 28/44 (63%) Frame = +1 Query: 31 RHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVA 162 R E +++A LAEF+ST +FVFAG+GS +A KL D A Sbjct: 13 RADEATHPDSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAA 56
>AQP5_HUMAN (P55064) Aquaporin-5 (AQP-5)| Length = 265 Score = 38.5 bits (88), Expect = 0.005 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +1 Query: 37 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +EV V LKA AEF++TLIFVF G GS + + P Sbjct: 3 KEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALP 40
>TIP41_ARATH (O82316) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (Epsilon-tonoplast intrinsic protein) (Epsilon-TIP) Length = 249 Score = 38.5 bits (88), Expect = 0.005 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +1 Query: 34 HREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKL 144 H E + +KA + EFI+T +FVFAG GS MA L Sbjct: 9 HSEAAKPDCIKALIVEFITTFLFVFAGVGSAMATDSL 45
>TIP31_ORYSA (Q9FWV6) Probable aquaporin TIP3.1 (Tonoplast intrinsic protein| 3.1) (OsTIP3.1) Length = 264 Score = 37.7 bits (86), Expect = 0.008 Identities = 21/55 (38%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +1 Query: 7 RKGLRW-IPRHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 R G R+ + R + ++AA++EF++T IFVFA +GS ++ KL D ++TP Sbjct: 7 RPGRRFTVGRSEDATHPDTIRAAISEFLATAIFVFAAEGSILSLGKLYQD-MSTP 60
>AQP5_SHEEP (Q866S3) Aquaporin-5 (AQP-5)| Length = 265 Score = 37.4 bits (85), Expect = 0.011 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 37 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +EV LKA AEF++TLIFVF G GS + + P Sbjct: 3 KEVCSAAFLKAVFAEFLATLIFVFFGLGSALKWPSAMP 40
>TIP41_ORYSA (Q75GA5) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (OsTIP4.1) Length = 251 Score = 37.0 bits (84), Expect = 0.014 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 34 HREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 H EV + G ++A LAE + T +FVF G + MA G A P Sbjct: 10 HGEVVDAGCVRAVLAELVLTFVFVFTGVAATMAAGVPEVAGAAMP 54
>AQP5_MOUSE (Q9WTY4) Aquaporin-5 (AQP-5)| Length = 265 Score = 37.0 bits (84), Expect = 0.014 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 37 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +EV V KA AEF++TLIFVF G GS + + P Sbjct: 3 KEVCSVAFFKAVFAEFLATLIFVFFGLGSALKWPSALP 40
>TIP31_ARATH (P26587) Aquaporin TIP3.1 (Tonoplast intrinsic protein 3.1)| (Alpha-tonoplast intrinsic protein) (Alpha-TIP) Length = 268 Score = 36.6 bits (83), Expect = 0.018 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +1 Query: 31 RHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKL 144 R E +++A LAEF+ST +FVFA +GS ++ KL Sbjct: 13 RADEATHPDSIRATLAEFLSTFVFVFAAEGSILSLDKL 50
>AQP5_RAT (P47864) Aquaporin-5 (AQP-5)| Length = 265 Score = 35.8 bits (81), Expect = 0.031 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +1 Query: 37 REVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +EV + KA AEF++TLIFVF G GS + + P Sbjct: 3 KEVCSLAFFKAVFAEFLATLIFVFFGLGSALKWPSALP 40
>TIP32_ORYSA (Q7XKI5) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (OsTIP3.2) Length = 265 Score = 35.4 bits (80), Expect = 0.040 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +1 Query: 55 GALKAALAEFISTLIFVFAGQGSGMAFSKLSPD 153 GA +AAL+EF++T +FVFA +GS K+ D Sbjct: 26 GATRAALSEFVATAVFVFAAEGSVYGLWKMYRD 58
>AQP2_RAT (P34080) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 34.3 bits (77), Expect = 0.090 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 40 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 150 E+ + +A LAEF++TL+FVF G GS + ++ P Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVFFGLGSALQWASSPP 39
>AQP2_MOUSE (P56402) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 34.3 bits (77), Expect = 0.090 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 40 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 150 E+ + +A LAEF++TL+FVF G GS + ++ P Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVFFGLGSALQWASSPP 39
>AQP2_DASNO (P79164) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 34.3 bits (77), Expect = 0.090 Identities = 15/29 (51%), Positives = 22/29 (75%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A LAEF++TLIFVF G GS +++ + P Sbjct: 6 RAVLAEFLATLIFVFFGLGSALSWPQALP 34
>TIP51_ORYSA (Q7XU31) Probable aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) (OsTIP5.1) Length = 269 Score = 33.5 bits (75), Expect = 0.15 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +1 Query: 58 ALKAALAEFISTLIFVFAGQGSGMAFSKLSPD 153 AL+A AEF ST +FVF GS ++ L+PD Sbjct: 16 ALRAYFAEFFSTFLFVFIAVGSTISARMLTPD 47
>AQP2_ORYAF (P79200) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 33.5 bits (75), Expect = 0.15 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSPDGV 159 KA +EF++TL+FVF G GS + + + P G+ Sbjct: 6 KAVFSEFLATLLFVFFGLGSALNWPQALPSGL 37
>TIP51_ARATH (Q9STX9) Putative aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) Length = 256 Score = 33.5 bits (75), Expect = 0.15 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +1 Query: 43 VYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATP 168 V + AL+ ++EFIST FV A GS M+ KL V+ P Sbjct: 16 VLSMNALRCYVSEFISTFFFVLAAVGSVMSSRKLMAGDVSGP 57
>AQP2_SHEEP (O62735) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 33.5 bits (75), Expect = 0.15 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 40 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 150 E+ + +A LAEF++TL+FVF G GS + + + P Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVFFGLGSALNWPQALP 39
>AQP2_HORSE (P79165) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 32.7 bits (73), Expect = 0.26 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A LAEF++TL+FVF G GS + + + P Sbjct: 6 RAVLAEFLATLLFVFFGLGSALNWPQAMP 34
>AQP2_BOVIN (P79099) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 32.3 bits (72), Expect = 0.34 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A LAEF++TL+FVF G GS + + + P Sbjct: 6 RAVLAEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_HUMAN (P41181) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 32.0 bits (71), Expect = 0.45 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 40 EVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSP 150 E+ + +A AEF++TL+FVF G GS + + + P Sbjct: 3 ELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALP 39
>AQP2_TALEU (O77740) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 31.6 bits (70), Expect = 0.58 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A AEF++TLIFVF G GS + + + P Sbjct: 6 RAVFAEFLATLIFVFFGLGSALNWQQSLP 34
>AQP2_PROHA (P79229) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 31.2 bits (69), Expect = 0.76 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A L+EF++TL+FVF G GS + + + P Sbjct: 6 RAVLSEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_CANFA (P79144) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 30.8 bits (68), Expect = 0.99 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A AEF++TL+FVF G GS + + + P Sbjct: 6 RAVFAEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_RABIT (P79213) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A AEF++TL+FVF G GS + + P Sbjct: 6 RAVFAEFLATLLFVFFGLGSALNWPSALP 34
>MYCB2_HUMAN (O75592) Probable ubiquitin ligase protein MYCBP2 (EC 6.3.2.-) (Myc| binding protein 2) (Protein associated with Myc) (Pam/highwire/rpm-1 protein) Length = 4641 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 155 PSGLSLLKAMPEPWPAKTKMSVEMNSASAALRAPTSYTSRCLGI 24 P G L+K EP P K + V +SA +R+ S S +GI Sbjct: 2413 PPGTQLVKPKSEPQPNKVRKFVAKDSAGLRIRSHPSLQSEQIGI 2456
>AQP2_ELEMA (P79168) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A +EF++TL+FVF G GS + + + P Sbjct: 6 RAVFSEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_DUGDU (O77714) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A +EF++TL+FVF G GS + + + P Sbjct: 6 RAVFSEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_AMBHO (O77697) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A +EF++TL+FVF G GS + + + P Sbjct: 6 RAVFSEFLATLLFVFFGLGSALNWPQALP 34
>MYCB2_MOUSE (Q7TPH6) Probable ubiquitin ligase protein MYCBP2 (EC 6.3.2.-) (Myc| binding protein 2) (Protein associated with Myc) (Pam/highwire/rpm-1 protein) Length = 4711 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -2 Query: 155 PSGLSLLKAMPEPWPAKTKMSVEMNSASAALRAPTSYTSRCLGIHR 18 P G L+K +P P K + V +SA +R+ S S +GI R Sbjct: 2408 PPGTQLVKPKADPQPNKIRKFVAKDSAGLRIRSHPSLQSEQIGIVR 2453
>AQP2_ERIEU (O77722) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A EF++TL+FVF G GS + + + P Sbjct: 6 RAVFTEFLATLLFVFFGLGSALNWPQALP 34
>AQP2_MACPR (P79803) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 111 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAFSKLSP 150 +A +EF++TL+FVF G GS + + P Sbjct: 6 RAVFSEFLATLLFVFFGLGSALNWPSTVP 34
>AQP1_HUMAN (P29972) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Urine water channel) Length = 268 Score = 28.1 bits (61), Expect = 6.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGSGMAF 135 +A +AEF++T +FVF GS + F Sbjct: 11 RAVVAEFLATTLFVFISIGSALGF 34
>AQP4_MOUSE (P55088) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 64 KAALAEFISTLIFVFAGQGS 123 KA AEF++TLIFV G GS Sbjct: 36 KAVSAEFLATLIFVLLGVGS 55
>DPO3A_BUCBP (Q89AN8) DNA polymerase III alpha subunit (EC 2.7.7.7)| Length = 1077 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 31 RHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSK 141 +HRE+++ GA + + +ST IF Q +G AF+K Sbjct: 726 KHREMFKNGAKENNINTKLSTKIFNLLEQFAGYAFNK 762
>APXL_HUMAN (Q13796) Apical-like protein (APXL protein)| Length = 1616 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 122 EPWPAKTKMSVEMNSASAALRAPTSYTSRCLG 27 EPW T + +N+ SAA +A TS R LG Sbjct: 840 EPWSRTTSLGDSLNAHSAAEKAGTSDLPRRLG 871 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,475,171 Number of Sequences: 219361 Number of extensions: 183747 Number of successful extensions: 862 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
