| Clone Name | baet49f04 |
|---|---|
| Clone Library Name | barley_pub |
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 32.3 bits (72), Expect = 0.37 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +3 Query: 72 MAATTMALSSPAMKLAGASYVLGGGRI 152 MAA TMALSSPA+ A+ V G GRI Sbjct: 1 MAAATMALSSPALAGKAAAKVFGEGRI 27
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 30.8 bits (68), Expect = 1.1 Identities = 20/33 (60%), Positives = 24/33 (72%), Gaps = 6/33 (18%) Frame = +3 Query: 72 MAATTMALSSP-----AMKLA-GASYVLGGGRI 152 MAA+TMALSSP A+KL+ AS VLG GR+ Sbjct: 1 MAASTMALSSPAFAGKAVKLSPAASEVLGSGRV 33
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 30.8 bits (68), Expect = 1.1 Identities = 20/33 (60%), Positives = 24/33 (72%), Gaps = 6/33 (18%) Frame = +3 Query: 72 MAATTMALSSP-----AMKLA-GASYVLGGGRI 152 MAA+TMALSSP A+KL+ GAS V G GR+ Sbjct: 1 MAASTMALSSPAFAGKAVKLSPGASEVFGTGRV 33
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 29.3 bits (64), Expect = 3.1 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 6/33 (18%) Frame = +3 Query: 72 MAATTMALSSPAMK------LAGASYVLGGGRI 152 MAA+TMALSSPA AS VLG GR+ Sbjct: 1 MAASTMALSSPAFAGKAVNLSPAASEVLGSGRV 33
>CB2C_LYCES (P14275) Chlorophyll a-b binding protein 1C, chloroplast precursor| (LHCII type I CAB-1C) (LHCP) (Fragments) Length = 265 Score = 28.1 bits (61), Expect = 6.9 Identities = 19/33 (57%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = +3 Query: 72 MAATTMALSSP-----AMKLA-GASYVLGGGRI 152 MAA TMALSSP A+KL+ AS + G GRI Sbjct: 1 MAAATMALSSPSFAGQAVKLSPSASEISGNGRI 33
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 28.1 bits (61), Expect = 6.9 Identities = 19/33 (57%), Positives = 22/33 (66%), Gaps = 6/33 (18%) Frame = +3 Query: 72 MAATTMALSSP-----AMKLA-GASYVLGGGRI 152 MAA TMALSSP A+KL+ AS + G GRI Sbjct: 1 MAAATMALSSPSFAGQAVKLSPSASEISGNGRI 33
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 28.1 bits (61), Expect = 6.9 Identities = 18/32 (56%), Positives = 22/32 (68%), Gaps = 5/32 (15%) Frame = +3 Query: 72 MAATTMALSSP-----AMKLAGASYVLGGGRI 152 MAA+TMALSS AMKLA ++ LG GR+ Sbjct: 1 MAASTMALSSSSLAGQAMKLAPSTPELGVGRV 32
>RTP3_MOUSE (Q5QGU6) Receptor-transporting protein 3 (Transmembrane protein 7)| Length = 474 Score = 27.7 bits (60), Expect = 9.0 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 16/61 (26%) Frame = -2 Query: 145 PPPRTYEAPASFIAGEESAMVVAAIAC---------CRME-------QSKLLMCGCCCD* 14 PP +Y P S S+ V+ I+ C++E QS+ CG CC+ Sbjct: 377 PPTSSYVPPTSSYVPPTSSSVIVPISSSWRLPENTICQVERNSHIHPQSQSSCCGACCES 436 Query: 13 W 11 W Sbjct: 437 W 437 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.122 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,573,051 Number of Sequences: 219361 Number of extensions: 152531 Number of successful extensions: 418 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)